Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpr119; Glucose-dependent insulinotropic receptor; G-protein coupled receptor 119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKF FTSILLLLPARNRGPERTRESAYHIVTISHPELDG
Uniprot No.

Target Background

Function
GPR119 is a receptor for the endogenous fatty acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). It functions as a glucose-dependent insulinotropic receptor, its activity mediated by G proteins that activate adenylate cyclase. It appears to act through a G(s)-mediated pathway.
Gene References Into Functions

GPR119 Function and Related Research:

  1. GPR119 is crucial for GLP-1 secretion in enteroendocrine cells, functioning as the oleoyl-lysophosphatidylinositol receptor. PMID: 29883799
  2. Beta-cell GPR119 expression is not essential for the physiological regulation of insulin secretion. PMID: 28254842
  3. GPR119 signaling is present in the mammalian eye, reducing intraocular pressure (IOP), notably in female mice. PMID: 28593245
  4. Angelica dahurica extract increases GPR119 activation, intracellular cAMP levels, GLP-1 levels, and glucose-stimulated insulin secretion. PMID: 27391814
  5. Fat-derived monoacylglycerols are potent candidates for mediating fat-induced GLP-1 release via GPR119 in vivo. PMID: 27297962
  6. GPR119 in L-cells is key to oral lipid-triggered GLP-1 secretion. PMID: 26144594
  7. GPR119 knockout prevents the therapeutic effects of Gordonoside F. PMID: 25246581
  8. Small-molecule GPR119 agonists with high receptor selectivity and glucose-stimulated insulin secretion capabilities have been identified. PMID: 24681896
  9. The GPR119 agonist HD0471042 effectively controlled glucose levels and prevented weight gain in type 2 diabetic mice. PMID: 23897163
  10. The GPR119 agonist AR231453 stimulates beta-cell replication and improves islet graft function. PMID: 22099761
  11. Combining a GPR119 agonist with a DPP-IV inhibitor may offer a novel therapeutic strategy for stimulating beta-cell regeneration and reversing diabetes. PMID: 23382843
  12. GPR119 activation/up-regulation in skeletal muscle impairs fatty acid and glucose oxidation; diet-induced obesity up-regulates skeletal muscle GPR119. PMID: 23069642
  13. In lean mice, 2-oleoylglycerol and linoleylethanolamine are physiologically relevant endogenous GPR119 agonists mediating receptor activation after nutrient uptake. PMID: 23074242
  14. GPR119 uses multiple pathways to regulate glucose homeostasis. PMID: 21068156
  15. N-oleoyldopamine (OLDA) and related hydroxybenzyl amides are potent GPR119 activators, suggesting lipid amides as modulators of glucose homeostasis. PMID: 19901198
  16. GPR119 is a potential therapeutic target for obesity and related metabolic disorders. PMID: 16517404
  17. Elevated Gpr119 mRNA levels in obese, hyperglycemic db/db mice suggest its involvement in obesity and diabetes development. PMID: 17070774
  18. AR231453 enhanced glucose-dependent insulin release and improved oral glucose tolerance in wild-type but not GPR119-deficient mice. PMID: 17289847
  19. GPR119 regulates glucose tolerance by affecting intestinal endocrine cells and pancreatic beta-cells. PMID: 18202141
  20. Oleoylethanolamine increases glucagon-like peptide-1 secretion from intestinal L-cells via GPR119 activation. PMID: 19208912
  21. GPR119 is important for incretin and insulin secretion but not appetite suppression. PMID: 19282326
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression restricted to the beta-cells of pancreatic islets.

Q&A

What is the basic structure of mouse GPR119 and how does it compare to human GPR119?

Mouse GPR119 belongs to the class A rhodopsin-like receptor family within the G protein-coupled receptor (GPCR) superfamily. The receptor consists of seven transmembrane helices connected by three extracellular and three intracellular regions, with the binding pocket formed in the transmembrane domain. Human GPR119 shares approximately 82% amino acid identity with mouse GPR119, while it shares 73.7% identity with rat GPR119 . This high degree of conservation suggests similar functional properties across these species, though some key differences in ligand binding and signaling exist. When designing studies, researchers should consider that the mouse GPR119 gene encodes a protein with similar topology to the human 335-amino acid protein but may respond differently to certain ligands due to subtle structural variations.

Where is GPR119 predominantly expressed in mice?

GPR119 is predominantly expressed in pancreatic β-cells and intestinal endocrine cells in mice. Specifically, it is highly expressed in the GLP-1-producing L cells and GIP-producing K cells of the gastrointestinal tract . This expression pattern directly relates to its physiological role in glucose homeostasis. Some studies have also detected GPR119 expression in mouse liver, brain (particularly the insular cortex), skeletal muscle, and myocardium, although there remains some controversy regarding the extent of expression in these tissues . When designing targeted experiments, researchers should anticipate the strongest physiological responses in pancreatic islets and intestinal tissue. For studying other potential sites of expression, highly sensitive detection methods such as quantitative PCR with validated primers or RNAscope may be necessary to resolve conflicting reports about expression levels.

How do specific mutations in mouse GPR119 affect its signaling properties and ligand interactions?

Specific mutations in mouse GPR119 can substantially alter its signaling properties and ligand interactions. Key residues in the transmembrane domains, particularly TM3, TM6, and TM7, have been identified as critical for ligand binding and receptor activation. Mutations in these regions can affect the binding affinity of both endogenous and synthetic ligands, as well as the efficiency of G protein coupling. The recent cryo-EM structure of GPR119 in complex with the agonist APD597 revealed that binding induces significant conformational changes, particularly in transmembrane helix 6 (TM6), which is crucial for receptor activation . When designing mutagenesis studies, researchers should focus on residues lining the orthosteric binding pocket identified in structural studies. Site-directed mutagenesis combined with functional assays measuring cAMP accumulation provides a powerful approach to assess how specific residues contribute to receptor function. Additionally, comparing the effects of mutations across species can provide insights into the molecular basis of species-specific responses to GPR119 ligands.

What signaling pathways are activated downstream of mouse GPR119?

Mouse GPR119 activation triggers multiple downstream signaling pathways, with the primary pathway involving coupling to stimulatory G protein α-subunit (Gαs) . This interaction leads to activation of adenylyl cyclase, resulting in increased intracellular cyclic AMP (cAMP) levels, which subsequently activates protein kinase A (PKA) and other cAMP-dependent effectors. Some evidence suggests that GPR119 may also interact with Gαi, Gαq, and β-arrestin, potentially enabling diverse signaling outcomes . In pancreatic β-cells, the elevation of cAMP contributes to enhanced glucose-dependent insulin secretion, while in intestinal endocrine cells, it promotes the release of incretin hormones, including GLP-1, GIP, and GLP-2 . When designing experiments to investigate GPR119 signaling, researchers should employ multiple complementary assays that measure different aspects of the signaling cascade, including cAMP accumulation, calcium mobilization (if Gαq coupling is suspected), and downstream effector phosphorylation. Time-course experiments are particularly valuable for distinguishing between immediate and delayed signaling events.

What are the optimal expression systems for producing functional recombinant mouse GPR119?

Several expression systems have been successfully used for producing functional recombinant mouse GPR119, each with distinct advantages for different research applications. For high-level expression suitable for structural studies, insect cell systems (particularly High Five cells) have proven effective, as demonstrated in the recent cryo-EM structure determination of GPR119 . For functional studies and screening assays, mammalian cell lines such as HEK293 and CHO-K1 are commonly employed due to their high transfection efficiency and mammalian protein processing capabilities. When designing expression constructs, researchers should consider including epitope tags (such as FLAG or strep tags) to facilitate detection and purification, as commercially available antibodies for GPR119 often lack specificity . For optimal surface expression, inclusion of signal peptides and careful consideration of codon optimization for the host system is recommended. To verify successful expression, flow cytometry using antibodies against N-terminal tags provides a reliable quantitative method .

How can I verify the functionality of recombinant mouse GPR119 in cell-based assays?

Verifying the functionality of recombinant mouse GPR119 requires demonstrating both appropriate expression and signaling capacity. A comprehensive approach includes multiple complementary assays. First, surface expression should be confirmed using flow cytometry with anti-FLAG M2-fluorescein isothiocyanate antibody if a FLAG tag was incorporated into the construct . Second, signaling functionality should be assessed through cAMP accumulation assays, as GPR119 primarily couples to Gαs to increase intracellular cAMP levels. Third, dose-response curves using known agonists such as APD597 should be generated to determine EC50 values and compare them to published values. Fourth, if the receptor is expressed in appropriate cell types (such as pancreatic β-cell lines), functional readouts like insulin secretion or GLP-1 release can provide physiologically relevant confirmation of activity. When conducting these assays, researchers should include appropriate positive controls (known GPR119 agonists) and negative controls (vehicle and untransfected cells) to ensure reliable interpretation of results.

What structural biology techniques have been most successful for studying mouse GPR119?

Single-particle cryo-electron microscopy (cryo-EM) has emerged as the most successful structural biology technique for studying GPR119, as evidenced by the recent determination of the structure of GPR119 in complex with the agonist APD597 and Gs protein at 2.8 Å resolution . This breakthrough followed years of unsuccessful attempts with other methods. For successful cryo-EM studies, researchers employed several key strategies: 1) Co-expression of GPR119 with its downstream G protein trimer in insect cells; 2) Addition of stabilizing components such as the antibody Nb35; 3) Incorporation of high-affinity agonists like APD597 to stabilize the active conformation; and 4) Careful optimization of detergent and buffer conditions during purification . While X-ray crystallography has been challenging for GPR119 due to its inherent flexibility, complementary techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) and molecular dynamics simulations can provide valuable insights into receptor dynamics and ligand interactions. Computational approaches based on homology modeling can also be useful for predicting binding modes of novel ligands when integrated with experimental validation.

How should GPR119 knockout or knockin mouse models be validated?

Thorough validation of GPR119 knockout or knockin mouse models is essential for ensuring reliable experimental outcomes. A comprehensive validation approach should include genetic, protein expression, and functional assessments. At the genetic level, complete sequencing of the modified locus is crucial to confirm the intended modification and rule out unintended alterations or insertions/deletions. For protein validation, multiple complementary approaches should be employed given the limitations of GPR119 antibodies. These include quantitative PCR to confirm absence of wild-type transcript in knockout models, Western blotting with validated antibodies when available, and immunohistochemistry in relevant tissues. Most importantly, functional validation should demonstrate phenotypic changes consistent with GPR119 modification, such as altered GLP-1 secretion in response to oral glucose challenge or modified insulin secretion patterns. Control experiments should include administration of specific GPR119 agonists like APD597, which should elicit responses in wild-type but not knockout animals. For knockin models expressing modified GPR119 variants, careful dose-response studies should be conducted to characterize any shifts in pharmacological properties compared to wild-type receptors.

What are the primary endogenous ligands for mouse GPR119?

The primary endogenous ligands for mouse GPR119 include several lipid-derived molecules. Oleoylethanolamide (OEA) is among the most studied endogenous GPR119 agonists. Additionally, lysophosphatidylcholine (LPC) was identified as one of the first de-orphanizing ligands for GPR119 . Perhaps most significantly, 2-monoacylglycerols (2-MAGs), particularly 2-oleoyl glycerol (2-OG), have been identified as highly effective natural agonists of GPR119 . These endogenous ligands are produced as metabolites during triglyceride metabolism and appear to serve as physiological regulators of GPR119 activity. When designing experiments to study endogenous activation of GPR119, researchers should consider the stability limitations of these compounds, particularly 2-OG. Some studies have employed 2-oleyl glyceryl, a more stable analog of 2-OG, to overcome stability issues in experimental settings . Additionally, researchers should be aware that these endogenous ligands may have multiple targets beyond GPR119, necessitating appropriate controls and complementary approaches to establish GPR119-specific effects.

How do synthetic agonists of GPR119 differ from endogenous ligands?

Synthetic agonists of GPR119 differ from endogenous ligands in several important aspects, making them valuable both as research tools and potential therapeutic agents. Synthetic agonists generally exhibit significantly higher potency than endogenous ligands. While endogenous ligands typically have EC50 values in the micromolar range, synthetic agonists like APD597 can achieve nanomolar potency . Synthetic agonists also demonstrate superior pharmacokinetic properties, including enhanced stability, solubility, and bioavailability compared to endogenous ligands. For example, APD597 produces high-concentration hydroxyl metabolites with extended half-lives after receptor binding, allowing for more sustained activation . Structurally, synthetic agonists often feature optimized scaffolds designed to maximize receptor interactions while minimizing off-target effects. When selecting agonists for research purposes, consideration should be given to both potency (EC50) and efficacy (maximum response) parameters, as some synthetic compounds may be highly potent but only partial agonists. Additionally, researchers should be aware that certain synthetic agonists may display species-specific differences in potency between mouse and human GPR119, which can complicate translational research.

What structural insights have been gained about ligand binding to mouse GPR119?

Recent structural studies using cryo-EM have provided critical insights into ligand binding mechanisms of GPR119. The structure of GPR119 in complex with the synthetic agonist APD597 revealed that the ligand binds to an orthosteric pocket formed within the transmembrane helical region . This binding pocket is composed of residues from multiple transmembrane domains, with particularly important contributions from TM3, TM5, TM6, and TM7. APD597 was unambiguously identified in this orthosteric pocket, allowing precise characterization of ligand-receptor interactions . The binding involves a combination of hydrophobic interactions, hydrogen bonding, and van der Waals forces. Specific residues in the lower half of the transmembrane domain pocket recognize common segments shared by homologous peptides, while non-conserved residues in the upper half interact with ligand-specific moieties . Molecular docking studies using this structural framework have further elucidated the binding modes of various APD597 derivatives and other synthetic agonists . These structural insights provide a rational basis for structure-based drug design targeting GPR119, potentially enabling the development of more selective and efficacious compounds.

How do modifications to ligand structure affect binding affinity and signaling outcomes?

Modifications to ligand structure can profoundly affect both binding affinity and signaling outcomes for GPR119, providing opportunities for developing agonists with optimized properties. Structure-activity relationship studies have revealed that subtle changes to ligand scaffolds can result in dramatic shifts in potency, efficacy, and signaling bias. For endogenous ligands like OEA and 2-OG, the acyl chain length and degree of saturation significantly impact receptor activation. For synthetic agonists, modifications to both the core scaffold and peripheral substituents can alter receptor interactions. Molecular docking techniques based on the recently solved GPR119 structure have allowed analysis of how APD597 derivatives and other synthetic agonists interact with GPR119, providing valuable structural frameworks for predicting the effects of chemical modifications . When designing modified ligands, researchers should consider potential species differences in receptor binding pockets, as certain modifications may have divergent effects on mouse versus human GPR119. Comprehensive pharmacological characterization should include not only binding affinity and potency measurements but also assessment of efficacy across multiple signaling pathways to identify potential biased agonism. This approach can lead to the development of ligands with more selective physiological effects, potentially separating beneficial metabolic effects from unwanted side effects.

How does GPR119 signaling interact with other metabolic pathways and receptors?

GPR119 signaling interacts with multiple metabolic pathways and receptor systems, creating a complex network that regulates energy homeostasis. One of the most significant interactions involves the incretin system, where GPR119-mediated release of GLP-1 and GIP activates their respective receptors (GLP-1R and GIPR) on pancreatic β-cells and other tissues . This creates a coordinated response involving multiple G protein-coupled receptors. Interestingly, co-activation of GPR119 and GPR40 (another lipid-sensing GPCR) has been shown to produce synergistic effects on incretin secretion, suggesting functional interaction between these receptor systems . At the intracellular level, GPR119 signaling intersects with metabolic sensing pathways involving AMPK and mTOR, potentially influencing cellular energy status and nutrient sensing. Additionally, GPR119 activation may indirectly modulate inflammatory pathways, as suggested by its anti-inflammatory effects in metabolic tissues with fatty liver disease . To effectively study these interactions, researchers should design experiments that specifically manipulate multiple pathways simultaneously, using combinations of selective agonists or antagonists. Genetic approaches employing double knockout models can provide definitive evidence of receptor interactions, while signaling studies using pathway-specific inhibitors can delineate intracellular cross-talk mechanisms.

How does GPR119 function differ between healthy and diabetic mouse models?

GPR119 function exhibits important differences between healthy and diabetic mouse models, with implications for both basic research and therapeutic development. In diabetic models, several alterations in GPR119 biology have been observed: 1) Changes in receptor expression levels, which may be either up- or down-regulated depending on the specific model and disease stage; 2) Altered responsiveness to both endogenous and synthetic ligands, potentially reflecting changes in receptor coupling efficiency or downstream signaling components; 3) Modified physiological outcomes of receptor activation, with some studies suggesting enhanced efficacy of GPR119 agonists in diabetic compared to healthy mice. These differences likely result from the complex metabolic adaptations that occur in diabetic states, including β-cell dysfunction, peripheral insulin resistance, and altered incretin responsiveness. When conducting research using diabetic mouse models, it is essential to carefully characterize baseline GPR119 expression and function before investigating interventions. Multiple diabetic models should be employed when possible, as findings may differ between genetic models (e.g., db/db or ob/ob mice) and dietary or chemical induction models (high-fat diet or streptozotocin). Time-course studies are particularly valuable, as GPR119 function may change with disease progression. Additionally, researchers should consider sex differences, as growing evidence suggests sexual dimorphism in both diabetic pathophysiology and GPR119 function.

How can species differences between mouse and human GPR119 be addressed in translational research?

Addressing species differences between mouse and human GPR119 represents a critical challenge in translational research. Despite sharing 82% amino acid identity, mouse and human GPR119 exhibit important structural and functional differences that can affect drug discovery efforts . To overcome these challenges, researchers should implement several complementary strategies. First, comparative pharmacological profiling of candidate compounds against both mouse and human receptors in parallel assay systems can identify species-selective ligands early in the research pipeline. Second, humanized mouse models expressing human GPR119 in place of the mouse receptor can provide more translational in vivo systems for evaluating compound efficacy. Third, studies using human islets and intestinal organoids derived from human stem cells offer opportunities to validate findings in human tissues. Fourth, structural biology approaches comparing the binding pockets of mouse and human GPR119 can guide the design of compounds with consistent cross-species activity. Fifth, when species differences are unavoidable, establishing clear pharmacokinetic/pharmacodynamic relationships and identifying translational biomarkers can facilitate appropriate dose selection for human studies. Researchers should be particularly cautious when interpreting results with compounds showing significant species differences, as these may lead to translational failures if not properly accounted for during development.

What are emerging technologies for studying GPR119 trafficking and signaling dynamics?

Emerging technologies are revolutionizing our ability to study GPR119 trafficking and signaling dynamics with unprecedented spatial and temporal resolution. Advanced live-cell imaging approaches using fluorescently tagged GPR119 constructs enable real-time visualization of receptor internalization, recycling, and subcellular localization following ligand stimulation. Super-resolution microscopy techniques such as PALM, STORM, and STED can resolve receptor clustering and interactions with signaling partners at the nanoscale level. For studying signaling dynamics, FRET and BRET biosensors allow real-time monitoring of second messenger production, protein-protein interactions, and conformational changes in living cells. Optogenetic approaches are beginning to enable precise spatial and temporal control of GPR119 activation, allowing researchers to dissect the contribution of receptor signaling in specific cellular compartments. In vivo approaches are also advancing, with intravital microscopy allowing visualization of fluorescently labeled GPR119 in living tissues, while in vivo biosensors based on FRET or luciferase complementation can monitor signaling events in real-time in mouse models. When implementing these technologies, researchers should carefully validate tagged receptor constructs to ensure they maintain normal trafficking and signaling properties. Complementary approaches should be employed when possible, as each technology has specific limitations and strengths.

How can bioinformatics and computational approaches advance GPR119 research?

Bioinformatics and computational approaches offer powerful tools for advancing GPR119 research across multiple dimensions. Molecular dynamics simulations based on the recently solved cryo-EM structure can provide insights into receptor conformational dynamics, ligand binding mechanisms, and the structural basis of species differences. These simulations can capture microsecond-scale motions that are difficult to study experimentally. Virtual screening and molecular docking approaches facilitate the identification of novel GPR119 ligands with desired properties, significantly accelerating the drug discovery process. Network pharmacology analyses can predict potential off-target effects and polypharmacology, helping to explain complex in vivo observations. At the genomic level, analysis of GPR119 genetic variations across populations can identify potential associations with metabolic phenotypes or drug response variability. Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data can place GPR119 signaling within broader metabolic networks, revealing unexpected connections and regulatory mechanisms. When implementing computational approaches, researchers should validate key predictions experimentally, as even the most sophisticated computational methods have limitations. Hybrid approaches combining computational predictions with targeted experimental validation often yield the most robust insights.

What novel therapeutic strategies targeting GPR119 are being explored beyond traditional agonism?

Novel therapeutic strategies targeting GPR119 are expanding beyond traditional agonism to exploit the receptor's complex biology more fully. Biased agonists that selectively activate specific downstream signaling pathways (e.g., cAMP production over β-arrestin recruitment) represent a promising approach to potentially separate beneficial metabolic effects from unwanted side effects. Positive allosteric modulators (PAMs) that enhance the activity of endogenous ligands without directly activating the receptor may preserve the physiological timing and location of GPR119 activation while amplifying the response magnitude. Peptide-small molecule conjugates that combine GPR119 activation with targeting of other relevant receptors (such as GLP-1R) have shown promise in preclinical studies, potentially offering synergistic effects through coordinated receptor activation. Tissue-specific delivery approaches using prodrugs or nanoparticle formulations could enable preferential activation of GPR119 in target tissues while minimizing systemic exposure. Novel formulation strategies addressing the typically poor solubility of many GPR119 ligands may improve bioavailability and pharmacokinetic properties. When investigating these novel approaches, researchers should implement comprehensive characterization strategies that assess not only traditional pharmacological parameters but also pathway-specific activation, tissue distribution, and integration with endogenous signaling systems. Combinations of in vitro, ex vivo, and in vivo models are typically required to fully evaluate the potential of these advanced therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.