Recombinant Mouse Glutaminyl-peptide cyclotransferase-like protein (Qpctl)

Shipped with Ice Packs
In Stock

Description

Gene Information and Function

  • QPCTL Gene: QPCTL encodes an enzyme involved in the modification of proteins by catalyzing the formation of pyroglutamate from glutamine residues at the N-terminus of polypeptide chains . This modification can affect the protein's stability, activity, and interactions with other molecules .

Role in Cancer

  • Glioma Progression: QPCTL is essential for glioma cell proliferation and tumor growth and correlates positively with glioma cell stemness .

  • Prognostic Significance: The expression level of QPCTL affects the clinical outcomes of glioma patients . High and low expression levels are determined using the median mRNA expression value of QPCTL, and survival disparities are compared using Kaplan–Meier survival curves .

  • Independent Prognostic Factor: QPCTL has statistical significance in Cox regression analysis when the p-value is less than 0.05, indicating it as an independent prognostic factor for glioma patient survival .

  • Therapeutic Target: Inhibiting QPCTL can enhance the efficacy of PD-1, suggesting its potential as a target in cancer immunotherapy .

  • Immune Cell Interactions: QPCTL expression correlates with the infiltration of various immune cells in the tumor microenvironment . It was found that the expression of QPCTL was positively related to the immune infiltration in GBMLGG instead of LGG or GBM .

Protein-Protein Interactions

  • Interaction Network: QPCTL interacts with various proteins . The protein-protein interaction (PPI) network information can be obtained from the STRING website, considering a confidence score > 0.7 as significant .

  • Functional Prediction: Genemania is used to explore the interaction network of QPCTL .

Expression Analysis

  • Online Databases: The Gene Expression Profiling Interactive Analysis (GEPIA) database is used to analyze QPCTL expression in tumors and normal samples .

  • Immune Cell Markers: The relation of QPCTL expression with multiple markers for immune cells is investigated in the GEPIA database .

  • Correlation Validation: TIMER data validates genes significantly correlated with QPCTL expression in the GEPIA web .

Differential Gene Expression Analysis

  • Identification of DEGs: Differentially expressed genes (DEGs) between low- and high-QPCTL expression groups are identified using the DESeq 2 R package .

  • Functional and Enrichment Pathways: Functional and enrichment pathways (GO and KEGG) of DEGs are explored using the "cluster profiler" package in R .

  • GSEA Analysis: Gene Set Enrichment Analysis (GSEA) is performed using the ggplot2 R package to demonstrate the significant functions and pathways between the two groups .

DNA Methylation Analysis

  • DNA Methylation Level: The DNA methylation level of QPCTL in LGG and GBM is explored using DiseaseMeth .

  • Correlation with Survival: The correlation between the DNA methylation level of QPCTL and glioma patients’ survival is checked at https://ngdc.cncb.ac.cn/ewas/datahub . The QPCTL DNA methylation level of Chinese glioma patients is checked at the CGGA .

Role in Cardiovascular Function

  • pQTL Mapping: Quantitative trait loci (pQTL) mapping for cardiovascular proteins identifies genetic variants associated with protein levels .

  • Trans-pQTLs: Gene ontology (GO) analysis of genes assigned to all significant trans-pQTLs shows functional enrichment for chemokine binding, glycosaminoglycan binding, receptor binding, and G-protein coupled chemoattractant activity .

  • **Trans-pQTLs and Drug Targets: Trans- pQTLs represent causal relationships between gene variants and proteins and suggest new target candidates or repositioning opportunities using Mendelian randomization .

Tables and Figures Overview

Figure/TableDescription
Figure 5Correlation analysis between QPCTL expression and infiltrating immune cells, including data from GEO data single-cell sequencing, TIMER database, and TCGA TARGET GTEx.
Supplementary Figure 2Correlation between QPCTL expression and glioma patients’ survival in the CGGA database, considering primary and recurrent glioma patients in different WHO grades.
Supplementary Figure 3DNA methylation level of QPCTL in the CGGA database, considering different histology, pathological stages, genders, and ages of glioma patients.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Qpctl; Glutaminyl-peptide cyclotransferase-like protein; Golgi-resident glutaminyl-peptide cyclotransferase; isoQC; gQC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Qpctl
Target Protein Sequence
MSPGSRGRPRQRLEDRGLMKPPSLSKRRLLPRVQFLPLLLLALAMGLAFYIVWNSWHPGV EEMSRSRDLRVPLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFL EATLQSLSAGWHVELDPFTASTPLGPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLP PFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYG SRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRL HRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEAN LHPPTVHNLSRILAVFLAEYLGL
Uniprot No.

Target Background

Function

Recombinant Mouse Glutaminyl-peptide cyclotransferase-like protein (Qpctl) is responsible for the biosynthesis of pyroglutamyl peptides.

Database Links
Protein Families
Glutaminyl-peptide cyclotransferase family
Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in thalamus, hippocampus, brain cortex, cerebellum, kidney, lung and liver, and at low levels in heart and spleen.

Q&A

Basic Research Questions

  • What is the primary biochemical function of QPCTL in mouse models?

QPCTL catalyzes the formation of pyroglutamate residues at the NH2-terminus of proteins, thereby influencing their biological properties . This enzymatic activity is particularly important for:

  • Formation of the high-affinity SIRPα binding site on the CD47 "don't-eat-me" protein

  • Protection of monocyte chemoattractant proteins (MCPs) like CCL2 and CCL7 from DPP4-mediated truncation

  • Enhancement of chemokine stability and signaling capacity in vivo

The pyroglutamate modification increases chemokine resistance to aminopeptidases and enhances receptor signaling, as demonstrated with CCL2 and CX3CL1 .

  • What methodologies are effective for generating QPCTL-knockout mouse models?

QPCTL-deficient (QPCTL−/−) mouse models can be generated using CRISPR/Cas9 gene editing with the following protocol :

StepProcedureDetails
1CRISPR designTarget sgRNA to exon 2 of Qpctl gene (5'-GCACAATCAATAAGGGACGC-3')
2MicroinjectionPronuclear injection in mice zygotes with CRISPR/Cas9 mixture (50 ng/μl Cas9 RNA, 25 ng/μl sgRNA)
3Deletion confirmationCreate 811 bp deletion in exon 2 of the Qpctl gene
4GenotypingPCR using primers: Fwd_KO (5'-GTTTTAGGGATGGATGCCGC-3'), Fwd_WT (5'-GGACTCCTAGTAGGCAACGG-3'), Rev (5'-GGCTGTTTTGGGATCTTCGG-3')

This approach generates viable QPCTL-deficient mice on the C57BL/6JRj background that can be used for tumor challenge studies and other experiments .

  • How can I verify functional QPCTL knockout in experimental models?

Functional verification of QPCTL knockout can be conducted through multiple complementary methods :

  • SIRPα binding assay: Stain peripheral blood cells with mouse SIRPα and an anti-mouse CD47 antibody that recognizes CD47 independent of pyroglutamate formation. QPCTL−/− mice display significantly decreased SIRPα binding compared to wild-type littermates .

  • Chemokine modification analysis: Measure levels of pyroglutamate-modified chemokines (e.g., pE-CCL7) in serum using specific antibodies. QPCTL−/− mice show significantly reduced pE-CCL7 levels regardless of DPP4 activity .

  • Sequence validation: Perform sequence analysis of the relevant gene locus by TIDE analysis to confirm genomic disruption .

  • Phenotypic verification: Observe reduced circulating and splenic monocyte counts in QPCTL−/− mice, similar to the phenotype in mice lacking Ccr2, Ccl2, or Ccl7 expression .

  • What cell lines are appropriate for studying QPCTL function in tumor models?

Several mouse tumor cell lines have proven suitable for QPCTL research :

Cell LineTumor TypeCharacteristicsQPCTL Research Application
B16F10MelanomaHigh QPCTL expressionSyngeneic melanoma model for anti-PD-L1 therapy studies
EO771Breast cancerExpress Ccl2, Ccl7, and QpctlStudying monocyte migration to tumors
LL/2Lung carcinomaHigh frequency of infiltrating monocytesMonocyte-macrophage regulation studies
MC38-AMSColon adenocarcinomaCompatible with CRISPR/Cas9 editingGeneration of QPCTL-KO models

These cell lines can be effectively modified using CRISPR/Cas9 technology to create QPCTL-deficient variants for comparative studies .

Advanced Research Questions

  • How does QPCTL deficiency alter the tumor microenvironment (TME)?

QPCTL deficiency induces multiple changes in the TME that collectively promote anti-tumor immunity :

TME ComponentEffect of QPCTL DeficiencyFunctional Consequence
Macrophage-monocyte ratioAltered intra-tumoral monocyte-to-macrophage ratioReduced immunosuppressive myeloid infiltration
Cancer-associated fibroblasts (CAFs)~20-fold increase in inflammatory CAFs (iCAFs) relative to TGF-β-producing myofibroblastic CAFs (myCAFs)Enhanced pro-inflammatory microenvironment
Tumor cell signalingIncreased IFN pathway activity and decreased TGF-β pathway activityShift from immunosuppressive to pro-inflammatory state
Monocyte-derived populationsLoss of populations with immunosuppressive and pro-angiogenic profilesReduced tumor-promoting myeloid function

These changes collectively convert the TME to a pro-inflammatory environment that sensitizes tumors to immune checkpoint blockade therapy, particularly anti-PD-L1 treatment .

  • What is the specific protocol for generating QPCTL-knockout cell lines?

QPCTL-knockout (KO) cell lines can be generated using the following CRISPR/Cas9 protocol :

Method 1: Transfection-based approach

  • Transfect cells with pLentiCRISPR v.2 vector encoding sgRNA targeting murine QPCTL (5'-TATTGATTGTGCGACCCCCG-3')

  • Supplement culture medium with 2 μg/ml puromycin for at least 2 days

  • Sort selected cells based on αmCD47-MIAP301^hi^ mSIRPα-Fc^lo^ phenotype

  • Isolate and expand single cells, then pool approximately 50 knockout clones

Method 2: Transduction-based approach

  • Transduce cells with pLentiCRISPR v.2 vector encoding sgRNA targeting murine QPCTL

  • Supplement culture medium with 2 μg/ml puromycin for at least 4 days

  • Isolate and expand single cells, then pool 12 knockout clones

Validation of knockout can be performed by sequence analysis of the gene locus by TIDE analysis and by flow cytometry for SIRPα binding capacity .

  • What is the molecular mechanism by which QPCTL regulates monocyte homeostasis?

QPCTL regulates monocyte homeostasis through a precise molecular mechanism involving chemokine modification :

  • QPCTL catalyzes the formation of pyroglutamate residues (pE) at the N-terminus of monocyte chemoattractant proteins (MCPs), including CCL2 and CCL7

  • This modification protects MCPs from DPP4-mediated N-terminal truncation, which would otherwise inactivate them

  • The pE-modified chemokines show enhanced receptor signaling capacity and increased resistance to proteolytic degradation

  • In QPCTL−/− mice, MCPs remain unmodified and susceptible to DPP4 degradation

  • The resulting loss of functional chemokines disrupts monocyte mobilization from bone marrow to circulation

This mechanism is specific to QPCTL, as studies with QPCT−/−QPCTL−/− double knockout mice demonstrate that QPCT cannot compensate for QPCTL loss in MCP modification .

  • How does QPCTL deficiency impact response to immunotherapy?

QPCTL deficiency significantly enhances response to immunotherapy through multiple mechanisms :

ParameterEffectEvidence
Anti-PD-L1 efficacySynergizes with anti-PD-L1 therapyQPCTL deletion sensitizes otherwise refractory B16F10 melanoma model to checkpoint inhibition
T cell responseEnhanced CD8+ T cell expansionCombined QPCTL deficiency and anti-PD-L1 treatment expands CD8+ T cells
Tumor growthReduced tumor progressionSignificant reduction in tumor growth with combination therapy compared to either intervention alone
Macrophage polarizationShift toward pro-inflammatory phenotypeAltered macrophage-monocyte ratio favoring anti-tumor immunity
Fibroblast populationEnhanced inflammatory CAF phenotype~20-fold increase in inflammatory versus myofibroblastic CAFs

These findings provide a strong rationale for developing strategies to inhibit QPCTL activity as a means to enhance the efficacy of immune checkpoint inhibitors in cancer treatment .

  • What experimental approaches can assess QPCTL's role in chemokine function?

Several experimental approaches can effectively evaluate QPCTL's impact on chemokine function :

In vitro assays:

  • Recombinant protein production: Generate Q-CCL7, pE-CCL7, and truncated CCL7 for comparative studies

  • Chemokine modification analysis: Measure formation of pyroglutamate-modified chemokines using specific antibodies

  • Receptor signaling assays: Assess CCR2 activation by different chemokine forms

In vivo models:

  • Intraperitoneal inflammation model: Inject various forms of recombinant chemokines and measure monocyte recruitment to peritoneal cavity

  • DPP4 inhibition studies: Treat QPCTL−/− mice with DPP4 inhibitors to rescue monocyte mobilization

  • Genetic approach: Cross QPCTL−/− and DPP4−/− mouse strains to analyze the interplay between these enzymes

Tumor models:

  • Syngeneic tumor challenges in QPCTL−/− mice with wild-type or QPCTL-deficient tumor cells

  • Single-cell RNA sequencing to characterize myeloid populations in the TME

  • Flow cytometric analysis of tumor-infiltrating immune cells

These approaches provide complementary insights into QPCTL's role in chemokine function and immune cell recruitment .

  • How do QPCTL and CD47 interact to regulate phagocytosis in the tumor microenvironment?

The QPCTL-CD47 interaction represents a critical regulatory axis for phagocytosis in the tumor context :

  • QPCTL catalyzes the formation of pyroglutamate residues at the NH2-terminus of CD47, creating the high-affinity binding site for SIRPα

  • This modification is essential for CD47 to function as an effective "don't-eat-me" signal that prevents macrophage-mediated phagocytosis

  • In QPCTL−/− mice, blood cells display significantly decreased SIRPα binding compared to wild-type littermates, confirming QPCTL's critical role as a CD47 modifier in vivo

  • The impaired CD47-SIRPα interaction in the absence of QPCTL likely contributes to enhanced phagocytic activity in the tumor microenvironment

  • Interference with QPCTL activity, and hence CD47 maturation, represents a potential therapeutic strategy to promote anti-tumor immunity by enhancing phagocytosis of tumor cells

This mechanism provides an additional explanation for why QPCTL deficiency can enhance anti-tumor immune responses beyond its effects on chemokine regulation.

  • What are the limitations of current QPCTL research models?

Current QPCTL research models have several important limitations to consider :

  • Developmental effects: Germline deletion of QPCTL may lead to developmental alterations that influence the host's response to tumor challenge, potentially affecting the differentiation capacity of certain CAF or immune subsets independent of QPCTL activity during tumor outgrowth .

  • Model specificity: Available glutaminyl cyclase inhibitors likely inhibit both QPCTL and QPCT due to the similarity of their active sites, making it difficult to distinguish between the effects of QPCTL versus QPCT inhibition .

  • Translational gaps: While mouse models demonstrate QPCTL's role in regulating the TME, translating these findings to human cancers requires further validation.

  • Temporal dynamics: Current models provide limited information about the temporal dynamics of QPCTL's effects on immune cell recruitment and function during tumor progression.

  • Substrate identification: Around 600 human proteins harbor an N-terminal glutamine or glutamic acid residue after predicted signal peptide cleavage, suggesting many additional QPCTL substrates may exist beyond those currently identified .

Understanding these limitations is crucial for interpreting experimental results and designing future studies to address existing knowledge gaps.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.