Recombinant Mouse Glycerol-3-phosphate acyltransferase 3 (Agpat9)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Mouse Glycerol-3-phosphate acyltransferase 3 (Agpat9) is a bioengineered enzyme produced via recombinant DNA technology. It belongs to the 1-acylglycerol-3-phosphate O-acyltransferase (AGPAT) family, which catalyzes the sn-2 acylation of lysophosphatidic acid (LPA) to form phosphatidic acid, a precursor for phospholipids and triglycerides .

Key identifiers:

  • Gene Names: Agpat9, Gpat3, 1-AGPAT 9, LPAAT-theta

  • UniProt ID: Q8C0N2

  • Synonyms: Glycerol-3-phosphate acyltransferase 3, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9 .

Enzymatic Activity and Substrate Specificity

Agpat9 functions in the de novo synthesis of glycerophospholipids and triglycerides. Key findings include:

  • Substrate Preference: Acyl-CoA (e.g., palmitoyl-CoA, oleoyl-CoA) and LPA .

  • Localization: Co-localizes with AGPAT1 in the endoplasmic reticulum (ER) .

  • Catalytic Role: Sn-2 acylation of LPA to phosphatidic acid, a precursor for membrane phospholipids and storage lipids .

Table 1: Comparative Analysis of AGPAT9 Activity

IsoformTissue ExpressionEnzymatic ActivityLocalization
AGPAT9Lung >> Spleen > Brain AGPAT activity (sn-2 acylation)ER
AGPAT1UbiquitousAGPAT activityER

Tissue Distribution and Functional Relevance

Native Agpat9 is highly expressed in mouse lung and spleen, with moderate levels in brain, heart, and placenta . Its recombinant form is used to study lipid metabolism in these tissues.

Key Research Findings:

  • Lung and Spleen: Critical for phospholipid synthesis in alveolar type II cells and immune cells .

  • Species Variability: Rat Agpat9 is also expressed in the stomach, unlike in mice .

  • Redundancy: Co-expression with AGPAT1 in CHO cells shows functional overlap in ER domains .

Applications in Research

Recombinant Agpat9 is utilized in:

  1. Enzymatic Studies: Investigating substrate specificity and catalytic mechanisms .

  2. Disease Modeling: Exploring roles in obesity, metabolic disorders, and lipid-related pathologies .

  3. Structural Biology: Mapping conserved motifs (e.g., PHX4D, EGTC) via X-ray crystallography .

Research Highlights and Controversies

  • Catalytic Motifs: Substitutions in PHX4D (e.g., Pro replacing Asn) do not abolish AGPAT activity, challenging earlier assumptions about motif essentiality .

  • Functional Redundancy: Co-expression with AGPAT1 suggests overlapping roles but distinct tissue-specific functions .

  • Pathophysiological Links: Agpat9’s expression in lung and spleen implicates it in pulmonary surfactant synthesis and immune cell membrane remodeling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gpat3; Agpat9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Acyl-CoA:glycerol-3-phosphate acyltransferase 3; mGPAT3; Lysophosphatidic acid acyltransferase theta; LPAAT-theta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gpat3
Target Protein Sequence
MEGADLAVKLLSTWLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGAPKE SALKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISPRLTMVWVLGVLVRYCFLLPLRVTLAFIGISLLIIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILAT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLVSYLLRIMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ KNYSKMIVGNGSPNLARD
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by adding an acyl moiety at the sn-1 position of the glycerol backbone. It also converts LPA to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by adding an acyl moiety at the sn-2 position.
Gene References Into Functions
  1. Studies have identified GPAT3 as a novel enzyme involved in intestinal lipid metabolism. PMID: 26644473
  2. GPAT3 is the primary GPAT in white adipose tissue and plays a crucial role in regulating energy, glucose, and lipid homeostasis. PMID: 24714397
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundant in epididymal fat, followed by small intestine, brown adipose tissue, kidney, heart and colon.

Q&A

What is Agpat9 and what alternative names should researchers be aware of?

Agpat9 (1-acylglycerol-3-phosphate O-acyltransferase 9) is also known as LPCAT1 (lysophosphatidylcholine acyltransferase 1) in scientific literature. This enzyme plays a key role in catalyzing the conversion of glycerol-3-phosphate to lysophosphatidic acid during the synthesis of triacylglycerol. The nomenclature distinction is important when conducting literature searches, as publications may refer to this enzyme under either name. Researchers should be aware of both designations to ensure comprehensive literature review when planning experiments involving this enzyme . Understanding its proper naming convention is essential for accurately comparing findings across mouse and human studies, as the enzyme functions are largely conserved across species despite some structural differences.

What is the significance of Agpat9 in lipid metabolism pathways?

Agpat9 occupies a critical position in phospholipid remodeling and triacylglycerol synthesis pathways. This enzyme contributes to membrane phospholipid homeostasis, the non-inflammatory platelet-activation factor remodeling pathway, and plays an important role in retinal photoreceptor homeostasis. Recent research has also implicated Agpat9 in cancer progression, suggesting its involvement in multiple biological processes beyond basic lipid metabolism . The enzyme's ability to transfer acyl groups to lysophospholipids makes it a key player in maintaining cellular membrane integrity and function. Studies examining knockout mouse models have revealed physiological disruptions in multiple organ systems, highlighting the fundamental importance of Agpat9 in normal cellular metabolism and tissue function.

What are the most effective methods for cloning and expressing recombinant mouse Agpat9?

For successful cloning and expression of recombinant mouse Agpat9, researchers should consider the following methodological approach: First, design primers that target the complete open reading frame, with careful attention to potential alternative start sites, as both short and long forms of the protein have been documented. The cloning strategy should incorporate restriction sites (such as BamHI and XhoI) that facilitate directional insertion into expression vectors. For mammalian expression, vectors like pcDNA3.1 have proven effective. When expressing the protein in cell culture systems, CHO cells have demonstrated good expression levels and proper localization of the enzyme . The incorporation of epitope tags (V5 or EGFP) at the N-terminus rather than C-terminus is recommended to prevent interference with the catalytic domain function. Researchers should verify expression through both Western blotting and functional enzyme activity assays to ensure the recombinant protein retains proper folding and activity.

What specific considerations should be made when designing overexpression experiments with Agpat9?

When designing overexpression experiments with Agpat9, researchers must carefully consider several methodological aspects. First, select an appropriate vector system based on experimental goals - lentiviral vectors have shown consistent results for stable integration and long-term expression. The choice between constitutive promoters versus inducible systems should be determined by experimental requirements, as constitutive overexpression might affect cell viability in some cell types. Researchers should include proper controls including empty vector transduced cells to account for vector effects. Verification of overexpression should employ both RT-PCR and Western blot analyses, comparing expression levels to endogenous Agpat9 in relevant tissues or cell lines . Additionally, phenotypic changes resulting from overexpression should be systematically assessed through multiple complementary assays including proliferation assays (CCK-8, xCELLigence), migration assays (Transwell, wound healing), and biochemical measurements of enzymatic activity to establish functional consequences.

What are the most reliable methods for measuring Agpat9 enzymatic activity in vitro?

For accurate assessment of Agpat9 enzymatic activity, researchers should employ radiometric or fluorometric assays that directly measure the transfer of acyl groups to lysophospholipid substrates. A well-established protocol involves incubating purified recombinant enzyme or cell lysates with radiolabeled acyl-CoA and an appropriate lysophospholipid acceptor, followed by lipid extraction and thin-layer chromatography (TLC) to separate and quantify reaction products. Alternatively, HPLC-based methods offer higher sensitivity for detecting non-radiolabeled products. When analyzing results, researchers should include appropriate negative controls (heat-inactivated enzyme) and positive controls (commercially available acyltransferases) to validate assay performance . Temperature, pH, and buffer composition significantly impact enzymatic activity, so optimization of these parameters is essential for reproducible results. Additionally, substrate specificity assays using various lysophospholipid species and acyl-CoA donors provide important insights into the enzyme's preference and physiological function.

How does Agpat9 expression affect cellular pH regulation and V-ATPase activity?

Agpat9 plays a significant role in regulating intracellular and extracellular pH through modulation of V-ATPase activity. Studies have demonstrated that overexpression of Agpat9 significantly reduces V-ATPase activity, resulting in decreased proton secretion and impaired recovery from intracellular acidification. This regulatory mechanism operates through the Agpat9-mediated increase in LASS2 expression, which subsequently binds to ATP6V0C, a subunit of the V-ATPase proton pump. The physiological importance of this regulation has been demonstrated using NH4Cl prepulse experiments, where Agpat9-overexpressing cells showed markedly impaired intracellular pH recovery compared to control cells . This pH regulatory function appears to be particularly important in cancer progression, as altered pH homeostasis is a hallmark of aggressive cancer phenotypes. Researchers investigating this pathway should employ pH-sensitive fluorescent probes like BCECF to monitor changes in intracellular and extracellular pH in real-time following manipulation of Agpat9 expression levels.

What signaling pathways are affected by Agpat9 activity in cell proliferation and migration?

Agpat9 influences multiple signaling pathways involved in cell proliferation and migration, with particularly strong effects on the Wnt/β-catenin pathway and matrix metalloproteinase (MMP) activity. Research has demonstrated that Agpat9 overexpression significantly decreases active MMP-2 and MMP-9 levels in cellular supernatants, while Agpat9 knockdown increases these activities. This regulation of MMPs appears to be mediated through LASS2-dependent mechanisms. Additionally, Agpat9 upregulates KLF4 expression, which directly binds to the LASS2 promoter region, as confirmed by chromatin immunoprecipitation (ChIP) assays . When investigating these signaling networks, researchers should employ multiple complementary techniques, including real-time quantitative RT-PCR, western blotting, and activity assays for key pathway components. Time-course analyses are particularly valuable for distinguishing primary from secondary effects following Agpat9 expression changes, and pathway inhibitors should be utilized to establish causative relationships rather than correlative associations.

How is Agpat9 expression regulated at the transcriptional and post-transcriptional levels?

The regulation of Agpat9 expression involves complex mechanisms at both transcriptional and post-transcriptional levels. Transcriptional regulation appears tissue-specific, with distinct expression patterns observed across different tissues. While the complete regulatory mechanisms remain to be fully elucidated, evidence suggests involvement of tissue-specific transcription factors and enhancer elements. At the post-transcriptional level, mRNA stability and alternative splicing contribute to expression control, as evidenced by the identification of both short and long forms of Agpat9 . Researchers investigating Agpat9 regulation should employ promoter-reporter assays to identify key regulatory elements, RNA stability assays to assess post-transcriptional regulation, and examination of epigenetic modifications including DNA methylation and histone modifications at the Agpat9 locus. Additionally, the potential role of microRNAs in regulating Agpat9 expression represents an important area for future investigation, as several predicted microRNA binding sites exist in the 3' UTR region of Agpat9 mRNA.

What is the role of Agpat9 in breast cancer progression and metastasis?

Agpat9 demonstrates significant tumor-suppressive properties in breast cancer models through multiple mechanisms affecting proliferation, migration, and invasion. In vitro studies have established that overexpression of Agpat9 in highly invasive breast cancer cells (MDA-MB-231) significantly inhibits cell proliferation, as measured by CCK-8 assays (P = 0.0009) and real-time xCELLigence monitoring (P < 0.0001). Conversely, knockdown of Agpat9 in poorly invasive breast cancer cells (MCF7) significantly increases proliferation (P = 0.0094). Colony formation assays further confirm these effects . The anti-metastatic function of Agpat9 is demonstrated through migration and invasion assays, where Agpat9 overexpression significantly reduces both migration (P = 0.0095) and invasion (P = 0.0418) of breast cancer cells. This tumor-suppressive function operates through upregulation of LASS2 and KLF4, influencing V-ATPase activity, MMP-2/9 levels, and pH regulation. In vivo xenograft models confirm these findings, with AGPAT9 knockdown accelerating tumor growth and AGPAT9 overexpression reducing lung metastasis formation.

How can mouse models be effectively used to study Agpat9 function in vivo?

For effective in vivo investigation of Agpat9 function, researchers should consider two primary mouse model approaches: xenograft models and genetic mouse models. In xenograft studies, both subcutaneous implantation and tail vein injection models provide valuable information on different aspects of Agpat9 function. The subcutaneous model is particularly valuable for measuring primary tumor growth, while the tail vein injection model better reflects metastatic potential. When establishing these models, researchers should consider the following methodological details: For subcutaneous models, estrogen supplementation (17β-estradiol pellets) is necessary when using estrogen-dependent cell lines like MCF7. Cell numbers should be optimized (typically 1×10^7 cells for subcutaneous models and 1.5×10^6 for tail vein injection), and tumor measurements should begin once volumes reach approximately 100 mm^3 . For genetic mouse models, both conventional knockout and conditional tissue-specific knockout approaches can be employed, with the latter being particularly valuable for distinguishing developmental versus physiological functions of Agpat9. Phenotypic assessment should include histological analysis, measurement of serum lipid profiles, and tissue-specific enzymatic activity assays.

What experimental approaches can detect interactions between Agpat9 and other cellular proteins?

To investigate protein-protein interactions involving Agpat9, researchers should employ multiple complementary techniques to validate interactions and determine their functional significance. Co-immunoprecipitation (Co-IP) represents a foundational approach for detecting native protein complexes, requiring antibodies with high specificity for either Agpat9 or its potential binding partners. For enhanced sensitivity, proximity ligation assays (PLA) can detect interactions in intact cells with visualization of individual interaction events. Chromatin immunoprecipitation (ChIP) has successfully demonstrated interaction between KLF4 and the LASS2 promoter in the Agpat9 regulatory pathway . When conducting these experiments, epitope-tagged versions of Agpat9 can facilitate detection, with both V5-tagged and EGFP-tagged constructs having been successfully employed . Researchers should be cautious about tag positioning, preferring N-terminal tags to avoid interfering with C-terminal functional domains. Confirmation of interactions should include both forward and reverse Co-IP approaches, and functional validation through mutational analysis of interaction domains provides strong evidence for biological relevance of detected interactions.

How can subcellular localization of Agpat9 be accurately determined?

Determining the precise subcellular localization of Agpat9 requires multiple complementary imaging techniques combined with biochemical fractionation approaches. Fluorescence microscopy using EGFP-tagged Agpat9 constructs provides valuable initial localization data, though researchers must verify that the tag does not disrupt normal trafficking. Confocal microscopy with co-staining for established organelle markers (ER, Golgi, mitochondria, plasma membrane) can reveal the primary sites of Agpat9 residence. For EGFP-tagged constructs, cells should be grown on cover slips and fixed/permeabilized with methanol prior to imaging . Subcellular fractionation followed by Western blotting provides biochemical confirmation of microscopy findings. For comprehensive analysis, researchers should employ both N-terminally and C-terminally tagged constructs, as tag position may affect localization. Additionally, electron microscopy with immunogold labeling offers the highest resolution for precise organelle localization. Researchers should also investigate potential translocation of Agpat9 between compartments under different physiological conditions or following stimulation with relevant agonists.

What are the methodological challenges in distinguishing the enzymatic activities of different AGPAT family members?

Distinguishing the enzymatic activities of different AGPAT family members presents several methodological challenges due to overlapping substrate specificities and sequence similarities. Researchers should employ a systematic approach including: (1) Careful substrate specificity profiling using a diverse panel of lysophospholipid acceptors and acyl-CoA donors to identify preferential substrate combinations for each isoform; (2) Selective inhibitor studies, though limited by the current lack of highly specific inhibitors for individual AGPAT isoforms; (3) Expression systems with negligible endogenous acyltransferase activity to minimize background; (4) siRNA-mediated knockdown or CRISPR-Cas9 knockout of individual isoforms to determine their contribution to total cellular acyltransferase activity . When analyzing experimental results, researchers should account for potential compensatory upregulation of other family members following manipulation of Agpat9 expression. Kinetic analyses measuring Km and Vmax values for different substrates can provide additional discrimination between isoforms. Finally, mass spectrometry-based lipidomics approaches offer powerful tools for identifying the specific molecular species generated by different AGPAT family members under physiological conditions.

What considerations should be made when analyzing contradictory results in Agpat9 research?

When confronting contradictory results in Agpat9 research, investigators should systematically evaluate several potential sources of discrepancy. First, nomenclature confusion between AGPAT9 and LPCAT1 may lead to apparent contradictions when comparing studies using different terminology. Second, the existence of both short and long forms of the protein means experimental results may vary depending on which isoform was studied . Third, cell type-specific functions may explain divergent results, as Agpat9 exhibits different expression levels and potentially different functions across cell types. For example, the enzyme's role in cancer progression may differ between breast cancer subtypes or other cancer types. Fourth, methodological differences in overexpression or knockdown techniques, including the use of different vector systems or knockdown efficiencies, can significantly impact results . When analyzing seemingly contradictory findings, researchers should carefully examine experimental details including cell lines, constructs (noting whether short or long forms were used), and specific methodological parameters. Replication studies employing multiple cell lines and complementary methodological approaches provide the strongest resolution to contradictory findings.

What statistical approaches are most appropriate for analyzing Agpat9 expression data across different tissues?

When analyzing Agpat9 expression data across different tissues, researchers should employ a tiered statistical approach based on experimental design and data characteristics. For comparing expression across multiple tissues, one-way ANOVA followed by appropriate post-hoc tests (Tukey's or Bonferroni for all pairwise comparisons, or Dunnett's when comparing all tissues to a reference tissue) provides robust analysis. Data normalization requires careful consideration, with multiple reference genes (at least three) validated for stability across the studied tissues. For analyzing relationships between Agpat9 expression and continuous variables (such as disease progression markers), Pearson's correlation (for normally distributed data) or Spearman's rank correlation (for non-parametric data) should be employed . When performing these analyses, researchers should report specific P-values rather than simply stating significance thresholds, and clearly indicate which statistical tests were applied to which comparisons. Additionally, multivariate approaches including principal component analysis can reveal patterns in Agpat9 expression across tissue types that might not be apparent in univariate analyses.

How should researchers interpret changes in Agpat9 enzymatic activity versus expression levels?

Researchers must carefully distinguish between changes in Agpat9 enzyme activity and changes in expression levels, as these parameters do not always correlate directly. When analyzing experimental results, consider that post-translational modifications, protein-protein interactions, or substrate availability may alter enzymatic activity without affecting protein levels. Conversely, changes in expression might not proportionally translate to activity changes if rate-limiting steps exist elsewhere in the pathway. For comprehensive analysis, researchers should measure both mRNA (using qRT-PCR) and protein levels (using Western blotting), alongside direct enzymatic activity assays . Time-course experiments can reveal temporal relationships between expression and activity changes, helping distinguish cause-effect relationships. When interpreting data, researchers should correlate activity measurements with functional outcomes (cell proliferation, migration, pH regulation) to establish physiological relevance. Additionally, calculation of the ratio between enzymatic activity and protein expression can provide valuable insights into potential post-translational regulation mechanisms affecting specific activity of the enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.