Recombinant Mouse Glycerophosphodiester phosphodiesterase domain-containing protein 4 (Gdpd4)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Gdpd4 is implicated in lipid metabolism, particularly in the hydrolysis of glycerophosphodiester bonds. While its precise physiological role remains under investigation, studies highlight:

Enzymatic Activity

  • Catalytic Role: Hydrolyzes glycerophosphodiester substrates (e.g., glycerophosphoinositol) .

  • Metabolic Pathways: Linked to phosphoric diester hydrolase activity and lipid remodeling .

Knockout Studies

  • Fertility Research: Gdpd4 knockout (KO) mice showed no significant fertility defects, unlike other glycerophosphodiesterase-deficient models (e.g., Lypd4 KO) .

  • Sperm Function: Gdpd4 KO sperm retained normal migration and zona pellucida binding ability, suggesting redundancy or non-essential roles in these processes .

Interactions and Pathways

Gdpd4 interacts with proteins involved in lipid metabolism and cellular signaling:

Functional PartnerInteraction TypeRoleSource
MECRPredictedFatty acid synthesis (mitochondrial)STRING
GPD2PredictedGlycerol-3-phosphate metabolismSTRING
ISYNA1PredictedInositol biosynthesisSTRING

Pathways:

  • Lipid Metabolism: GDPD4 is annotated in pathways regulating phospholipid turnover and membrane remodeling .

  • Mitochondrial Function: Interacts with mitochondrial enzymes (e.g., GPD2) .

Clinical and Genetic Relevance

While no direct disease associations are reported for Gdpd4, related glycerophosphodiesterases (e.g., GDPD1) are linked to lysophospholipid metabolism disorders . Genetic variants in Gdpd4 are cataloged in ClinVar and COSMIC but lack robust clinical evidence .

Research Applications

Gdpd4 is primarily used in:

  1. Enzymatic Studies: Testing substrate specificity and inhibitor efficacy.

  2. Cellular Localization: Immunofluorescence assays to map membrane-bound activity.

  3. Knockout Models: Exploring redundancy in glycerophosphodiesterase function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Gdpd4; Gde6; Glycerophosphodiester phosphodiesterase domain-containing protein 4; Glycerophosphodiester phosphodiesterase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gdpd4
Target Protein Sequence
MEETQDSSSSKPKNTDENFSLWIEQYFNHKCCITFLTGCYSCQWQYREWEKTELGSCCCS RKEQFFYMCLVIAFILSVLFLFVWVETSNEYNGFDWVVYLGTGCWFFWSILVLSAAGIMV AYTTLLLLLGFLLLWERIELNLHTSHKVFICLVIVLCSFLLAVLSHFWKDKWLIAGLSLQ IFAPFVHLSLITVMIIISWPLSICVARLESEVKVRRYRMADYEQEIQERCNVFQRLRALQ IAAGLSFLIILLCLYLMPLGIYSPCILKKENLGPKPTLFGHRGAPMLAPENTMMSFEKAV ELDVSGLETDIYLSFDSVPFLMHDYDLTRTTNIKEVLPSAAGNHTSNFNWTFLSTLNAGK WFLKHKPFFGMKPLSEADKRRAGNQSIPQLSELLALAKREQKIVIFDLFGPRPGHPLRNT FVRRVVKVILDSKIEQRLIFWLPGFDRDYVRFMAPGFQHVGRLWSIKDLTKHNITIINVD YKRLFYAGLRDYKEAKIYIHVYVINEPWLFSLAWCSSINSVTTDNIELLNQLSRPLFFMT PGFYMFMWLFLDIASAVIIGFVFCYNWIKEIKRERWLEAAASSGLLHSETITDITENNDA SQQKPEVAPTSANLAPENMIELQKTEPKTENL
Uniprot No.

Target Background

Database Links
Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Cytoplasm. Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in testis, in particular in spermatocytes.

Q&A

What is mouse Gdpd4 and what is its primary biological function?

Mouse Gdpd4 (also referred to as GDE4) is a member of the mammalian glycerophosphodiester phosphodiesterase family. Unlike other members of this family, Gdpd4 exhibits a distinct enzymatic profile. The protein shows 92% homology to human GDE4, suggesting evolutionary conservation of its function across mammalian species .

The primary function of Gdpd4 is not the typical glycerophosphodiester hydrolysis seen in other family members. Instead, it demonstrates lysophospholipase D activity, specifically hydrolyzing lysophosphatidylcholine (lyso-PC) and lyso-platelet-activating factor (lyso-PAF) to produce 1-acyl-lysophosphatidic acid (LPA) and alkyl-LPA, respectively . This activity suggests Gdpd4 plays a significant role in LPA signaling pathways, which are involved in numerous cellular processes including proliferation, migration, and survival.

What is the tissue expression pattern of mouse Gdpd4?

Mouse Gdpd4 exhibits a specific tissue distribution pattern that provides clues about its physiological roles. Based on experimental analyses, Gdpd4 is predominantly expressed in:

  • Intestinal epithelial cells

  • Spermatids

  • Macrophages

This expression pattern suggests potential roles in gastrointestinal function, reproductive processes, and immune response. The concentrated expression in these specific cell types rather than ubiquitous distribution implies specialized functions in these tissues.

How does the structure of mouse Gdpd4 relate to its function?

The structure-function relationship in Gdpd4 represents an interesting case of evolutionary adaptation within a protein family. While maintaining the core structural domain, the protein has developed altered substrate specificity, highlighting the plasticity of enzyme function through evolutionary processes.

What are the optimal methods for measuring Gdpd4 enzymatic activity?

The unique enzymatic profile of Gdpd4 requires specific methodological approaches for accurate activity measurement. Based on established protocols, researchers should consider the following methods:

  • Lysophospholipase D activity measurement:

    • Substrate preparation: Use lyso-PC or lyso-PAF as substrates

    • Detection method: Measure the produced LPA or alkyl-LPA

    • Alternative approach: Measure released choline as a reaction product

  • Negative control assays:

    • Test with glycerophosphoinositol (GroPIns) and glycerophosphocholine (GroPCho)

    • Expect negative results as Gdpd4 cannot hydrolyze these typical GP-PDE substrates

A typical experimental protocol includes:

  • Reaction mixture containing 50 mM HEPES-NaOH (pH 7.4)

  • 5 mM MgCl₂

  • Purified recombinant Gdpd4 protein

  • Appropriate substrate (lyso-PC or lyso-PAF)

  • Incubation at 37°C for optimal enzymatic activity

What expression systems are most effective for producing recombinant mouse Gdpd4?

When producing recombinant mouse Gdpd4 for research purposes, several expression systems have been documented with varying efficacy:

  • Mammalian expression systems:

    • HEK293 cells offer proper post-translational modifications

    • CHO cells provide high yield with maintained enzymatic activity

  • Purification approach:

    • Affinity chromatography using His-tag or GST-tag fusion proteins

    • Size exclusion chromatography for higher purity

For functional studies, it is crucial to confirm that the recombinant protein retains lysophospholipase D activity through enzymatic assays comparing activity against lyso-PC versus glycerophosphodiesters .

How does Gdpd4 contribute to lysophosphatidic acid (LPA) signaling pathways?

Gdpd4 represents a novel pathway for LPA and alkyl-LPA generation, which has significant implications for cellular signaling. The enzyme catalyzes the production of these bioactive lipid mediators through its lysophospholipase D activity .

LPA signaling affects numerous cellular processes through G protein-coupled LPA receptors, including:

  • Cell proliferation and survival

  • Cytoskeletal rearrangement

  • Cell migration

  • Inflammatory responses

The contribution of Gdpd4 to this pathway appears particularly significant in intestinal epithelial cells and macrophages, where the enzyme is highly expressed. This suggests tissue-specific roles in LPA-mediated functions, potentially including immune response modulation and epithelial barrier regulation .

What is the relationship between Gdpd4 and the PI3K/AKT/mTOR pathway?

Research indicates a potential relationship between Gdpd4 and the PI3K/AKT/mTOR signaling pathway, particularly in the context of cancer. Experimental evidence from prostate cancer studies shows that:

  • Silencing GDPD4-2 (a variant of GDPD4) reversed therapeutic effects of Astragaloside IV combined with polypeptide extract from scorpion venom (PESV)

  • This reversal occurred through regulation of the PI3K/AKT/mTOR pathway

This relationship suggests Gdpd4 may influence cell survival, proliferation, and metabolism through modulation of this critical signaling pathway. The mechanism might involve Gdpd4-mediated production of LPA, which is known to activate PI3K/AKT signaling in various cell types.

What role does Gdpd4 play in cancer development and progression?

Evidence suggests Gdpd4 may have significant implications in cancer biology, particularly in prostate cancer. Research findings indicate:

  • GDPD4-2 expression was decreased in prostate cancer tissues and LNCaP cells compared to normal controls

  • Modulation of GDPD4-2 affected responses to therapeutic compounds (Astragaloside IV-PESV) in prostate cancer models

The mechanism appears to involve regulation of the PI3K/AKT/mTOR pathway, which is crucial for cancer cell survival and proliferation. Furthermore, the enzyme's role in producing LPA may contribute to cancer progression, as LPA is known to promote proliferation, migration, and invasion in various cancer types.

How does Gdpd4 interact with autophagy pathways in disease models?

Research on prostate cancer models has revealed a potential connection between Gdpd4 and autophagy regulation:

  • Treatment with Astragaloside IV and PESV promoted the expression of autophagy markers LC3II and Beclin1 while inhibiting P62 expression

  • These effects were linked to Gdpd4-2 expression, suggesting a regulatory role in autophagy pathways

The exact molecular mechanisms require further investigation, but current evidence points to a connection between Gdpd4, the PI3K/AKT/mTOR pathway (a known regulator of autophagy), and autophagy itself. This relationship may be particularly relevant in cancer contexts, where autophagy modulation can affect therapeutic responses.

How does Gdpd4 enzymatic activity differ from other members of the GP-PDE family?

Gdpd4 exhibits distinctive enzymatic properties that set it apart from other members of the glycerophosphodiester phosphodiesterase family:

GP-PDE MemberGlycerophosphodiester HydrolysisLysophospholipase D ActivityPrimary Substrates
Gdpd4 (GDE4)NoYesLyso-PC, Lyso-PAF
GDE1YesNoGroPIns
GDE3YesNoGroPCho, GroPIns
GDE5YesNoMultiple glycerophosphodiesters
GDE7NoYesLyso-PC

Unlike canonical GP-PDEs, Gdpd4 cannot hydrolyze glycerophosphoinositol (GroPIns) or glycerophosphocholine (GroPCho). Instead, it specifically converts lyso-PC to LPA and lyso-PAF to alkyl-LPA through its lysophospholipase D activity . This functional divergence highlights the evolutionary diversification within this enzyme family.

What evolutionary relationships exist between Gdpd4 and other GP-PDE family members?

Phylogenetic analysis shows that Gdpd4 (GDE4) and GDE7 are closely related evolutionarily and form a distinct branch within the GP-PDE family tree. This close relationship correlates with their shared lysophospholipase D activity rather than canonical glycerophosphodiester hydrolysis .

The evolutionary divergence of Gdpd4 and GDE7 from other family members likely represents functional adaptation to fill specific biological niches in LPA signaling. The high degree of conservation between mouse and human orthologs (92% homology) suggests these functions are important across mammalian species .

What are effective methods for silencing Gdpd4 expression in research models?

Several approaches have proven effective for silencing Gdpd4 expression in experimental settings:

  • RNA interference (RNAi):

    • Short hairpin RNA (shRNA) targeting GDPD4 has been successfully used to generate stable knockdown cell lines

    • Example: sh-GDPD4-2 stable LNCaP cells have been established for prostate cancer studies

  • CRISPR-Cas9 gene editing:

    • Can be used for complete knockout of GDPD4

    • Allows for precise modification of specific domains to study structure-function relationships

  • Antisense oligonucleotides:

    • Alternative approach for transient knockdown

    • Useful for studying acute effects of GDPD4 inhibition

When designing silencing experiments, researchers should verify knockdown efficiency through both mRNA (RT-qPCR) and protein (Western blot) analyses to ensure complete suppression of Gdpd4 function.

What in vivo models are most suitable for studying Gdpd4 function?

Based on the tissue expression pattern and known functions of Gdpd4, several in vivo models have proven valuable for studying its physiological and pathological roles:

  • Cancer xenograft models:

    • BALB/c nude mice implanted with LNCaP cells (prostate cancer)

    • Allows for studying roles in tumor development and treatment response

    • Can be combined with Gdpd4 knockdown approaches

  • Tissue-specific knockout models:

    • Intestinal epithelial cell-specific Gdpd4 knockout

    • Macrophage-specific Gdpd4 knockout

    • Spermatid-specific Gdpd4 knockout

  • Inflammation models:

    • Given expression in macrophages, models of inflammatory conditions may reveal functional roles

    • Examples include DSS-induced colitis or thioglycollate-induced peritonitis

When designing in vivo experiments, researchers should consider the specific tissue expression pattern of Gdpd4 and select models that interrogate function in physiologically relevant contexts.

What are the key unresolved questions about Gdpd4 function and regulation?

Despite growing understanding of Gdpd4, several critical questions remain unanswered:

  • What are the upstream regulators of Gdpd4 expression and activity?

  • How is Gdpd4 activity modulated in response to various cellular stresses?

  • What is the three-dimensional structure of Gdpd4, and how does it explain the enzyme's unusual substrate specificity?

  • What is the full spectrum of physiological substrates for Gdpd4 beyond lyso-PC and lyso-PAF?

  • How does Gdpd4-mediated LPA production integrate with other LPA-generating pathways?

Addressing these questions will require interdisciplinary approaches combining structural biology, enzymology, cell biology, and in vivo models.

What emerging technologies might advance Gdpd4 research?

Several cutting-edge technologies hold promise for accelerating Gdpd4 research:

  • Cryo-electron microscopy:

    • Could resolve the three-dimensional structure of Gdpd4

    • Would provide insights into substrate binding and catalytic mechanism

  • Single-cell RNA sequencing:

    • Would reveal cell-specific expression patterns at high resolution

    • Could identify previously unknown cellular contexts of Gdpd4 expression

  • Lipidomics:

    • Mass spectrometry-based approaches to comprehensively analyze lipid changes

    • Would provide a fuller picture of Gdpd4's impact on the lipidome

  • Optogenetic control of Gdpd4 activity:

    • Could allow temporal regulation of enzyme activity

    • Would help dissect acute versus chronic effects of Gdpd4 function

These technologies, combined with established biochemical and cellular approaches, will likely yield significant advances in understanding Gdpd4 biology in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.