Recombinant Mouse Glycerophosphodiester phosphodiesterase domain-containing protein 5 (Gdpd5)

Shipped with Ice Packs
In Stock

Description

Tissue Distribution and Expression Patterns

Gdpd5 demonstrates widespread tissue expression in mammals, with notable presence in lung, heart, brain, kidney, and testis . Within the renal system, Gdpd5 is expressed in mouse inner medullary collecting duct (mIMCD3) cells, where it plays a crucial role in osmotic regulation . This broad distribution pattern suggests diverse physiological functions across multiple organ systems, particularly in tissues requiring precise regulation of membrane phospholipid metabolism and osmotic balance .

Research indicates that Gdpd5 expression is subject to osmotic regulation, with high NaCl concentrations reducing its mRNA abundance through increased degradation rates . This regulatory mechanism contributes to the adaptive response of cells to osmotic stress, particularly in specialized tissues like the renal medulla where maintaining proper osmotic gradients is physiologically essential .

Enzymatic Activity and Substrate Specificity

Gdpd5 functions primarily as a glycerophosphocholine phosphodiesterase (GPC-PDE), catalyzing the hydrolysis of glycerophosphocholine to produce glycerol-3-phosphate and choline . This enzymatic activity has been conclusively demonstrated through multiple experimental approaches. Immunoprecipitated recombinant Gdpd5-V5 from transfected HEK293 cells exhibits significant GPC-PDE activity in vitro, whereas control immunoprecipitates from cells transfected with empty vector show no such activity .

The enzymatic properties of Gdpd5 position it as a functional analog of previously characterized GPC-PDEs in other organisms, including Gde1p in yeast, which hydrolyzes GPC to provide choline for the Kennedy pathway of phosphatidylcholine synthesis . Unlike some related enzymes such as MIR16 (GDE1) that hydrolyze glycerophosphoinositol but not GPC, Gdpd5 demonstrates specificity for GPC as a substrate, reflecting its specialized role in phospholipid metabolism and osmotic regulation .

Role in Osmotic Regulation

A primary physiological function of Gdpd5 is its contribution to osmotic regulation through control of cellular GPC levels. GPC serves as an important osmoprotective organic osmolyte in renal medullary cells, and Gdpd5 regulates its abundance through GPC-PDE activity . Experimental evidence demonstrates that Gdpd5's activity is sensitive to osmotic conditions, with high NaCl or urea concentrations inhibiting its function both in cellular contexts and when assayed in vitro .

This osmotic sensitivity manifests through multiple regulatory mechanisms. When cells are exposed to elevated osmolality (from 300 to 700 mosmol/kg through addition of NaCl and urea), Gdpd5 mRNA expression decreases by approximately 47%, as shown in the following data:

GenemRNA ratio (700/300 mosmol/kg)
BC024955 (GDPD5)0.53
NM_023608 (GDPD2)1.66
AK122510 (mKIAA1434)0.91
NM_025638 (GDPD1)0.93
AK003726 (unknown)0.87

This transcriptional response contributes to decreased GPC-PDE activity under osmotic stress, allowing cellular GPC accumulation as an osmoprotective mechanism . Additionally, high NaCl specifically increases Gdpd5 mRNA degradation rate, further reducing its expression, though high urea does not demonstrate this particular effect .

Cellular GPC Regulation and Experimental Evidence

Direct experimental manipulation of Gdpd5 expression confirms its role in regulating cellular GPC levels. In mIMCD3 cells maintained at normal osmolality (300 mosmol/kg), siRNA knockdown of Gdpd5 by 55% increases cellular GPC concentration by 60% . Conversely, overexpression of recombinant Gdpd5-V5 increases GPC-PDE activity by 50% while decreasing cellular GPC by 30% . These reciprocal effects conclusively establish the enzymatic function of Gdpd5 in GPC metabolism and its physiological relevance to cellular osmotic balance.

The coordinated action of Gdpd5 with other enzymes involved in phospholipid metabolism, particularly neuropathy target esterase (NTE), appears to be critical for maintaining proper GPC levels during osmotic stress. While NTE catalyzes GPC synthesis from phosphatidylcholine, Gdpd5 mediates its degradation, with both enzymes regulated by osmotic conditions to permit GPC accumulation when needed for cellular protection .

Neuronal Development and Differentiation

Beyond its role in osmotic regulation, Gdpd5 demonstrates important functions in neuronal development and differentiation . Research has shown that Gdpd5 is necessary for spinal motor neuron differentiation and supports retinoid-induced neuronal outgrowth . These neurological functions may relate to Gdpd5's involvement in membrane phospholipid metabolism, as proper membrane composition and remodeling are essential aspects of neuronal development.

The dual role of Gdpd5 in both osmotic regulation and neuronal development suggests that its fundamental enzymatic activity in phospholipid metabolism serves diverse physiological purposes across different cellular contexts and tissues . This functional versatility highlights the importance of precise regulation of Gdpd5 expression and activity in maintaining cellular homeostasis.

Osmotic Stress Response Pathways

Gdpd5 activity and expression are regulated through multiple mechanisms in response to osmotic stress. At the functional level, exposure of cells to elevated NaCl or urea rapidly inhibits the GPC-PDE activity of Gdpd5 . This acute regulation permits immediate conservation of GPC under osmotic stress conditions, providing rapid osmoprotection before transcriptional responses can manifest.

At the transcriptional level, high NaCl specifically decreases Gdpd5 mRNA abundance through increased degradation rates . This selective effect contrasts with high urea exposure, which inhibits Gdpd5 enzymatic activity but does not affect its mRNA stability . The differential response to distinct osmotic stressors suggests complex regulatory pathways that fine-tune Gdpd5 function according to the specific nature of osmotic challenges.

Colocalization and Functional Coordination

Gdpd5 demonstrates specific subcellular localization patterns that support its functional role. The protein colocalizes with neuropathy target esterase (NTE) in the perinuclear region of HEK293 cells . This spatial coordination likely facilitates the complementary activities of these enzymes in phospholipid metabolism, with NTE generating GPC from phosphatidylcholine and Gdpd5 catalyzing its degradation .

The cooperative action of Gdpd5 and NTE appears critical for phosphatidylcholine homeostasis in mammalian cells, similar to the established relationship between their homologs in yeast (Gde1p and NTE1) . This functional cooperation extends to their roles in osmotic stress response, where both enzymes are regulated to promote GPC accumulation during hyperosmotic conditions .

Recombinant Production and Analysis

Recombinant mouse Gdpd5 serves as a valuable tool for investigating enzyme function and regulation. Standard production methods involve expression in E. coli systems with appropriate affinity tags (typically His-tag) to facilitate purification . The purified protein can be utilized for biochemical characterization, structural studies, and development of specific inhibitors or activators for research and potential therapeutic applications.

Quality control parameters for recombinant Gdpd5 typically include purity assessment by SDS-PAGE (>90% purity standard), proper storage conditions (-20°C/-80°C), and appropriate buffer formulation . Reconstitution protocols emphasize minimizing repeated freeze-thaw cycles to maintain enzymatic activity, with recommended addition of glycerol (5-50% final concentration) for long-term storage .

Functional Assays and Cellular Studies

Multiple experimental approaches have been employed to characterize Gdpd5 function:

  1. Immunoprecipitation and in vitro enzymatic assays demonstrate the GPC-PDE activity of recombinant Gdpd5

  2. siRNA knockdown studies reveal the impact of Gdpd5 depletion on cellular GPC levels

  3. Overexpression experiments confirm that increased Gdpd5 leads to enhanced GPC-PDE activity and reduced cellular GPC

  4. Immunofluorescence microscopy identifies the subcellular localization of Gdpd5 to the perinuclear region

These complementary approaches provide robust evidence for Gdpd5's physiological function and regulatory mechanisms. The ability to manipulate Gdpd5 expression and activity in cellular models offers powerful tools for investigating its roles in various physiological and pathological contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for precise delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage condition, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gdpd5; Gde2; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-607
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gdpd5
Target Protein Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLVCTFSLTLTWLY FWWGVHNDYDEFNWYLYNRMGYWSDWSVPILVTSAAAFTYIAGLLVLALCHIAVGQQLNL HWIHKMGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHIGALVAITALSWIVA GQFARAERSSSQLTILCTFFAVVFTFYLIPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTVMSFRKALEQRLYGLQADITISLDGVPFLMHDTTLRRTTNVEHLFPELARRPAAML NWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREVQNQSICSLAELLELAKGNASLLLNLR DPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVRKMAPGFQQTSGSKEAIAN LRKGHIQKLNLRYTQVSHQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT LSRVPSPLWIMPPDEYCLMWVTADLISFSLIIGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDELSVCSDSSYDTYANANSTATPVGPRNAGSRAKT VTEQSGH
Uniprot No.

Target Background

Function
Glycerophosphodiester phosphodiesterase that promotes neurite formation and drives spinal motor neuron differentiation. It mediates the cleavage of glycosylphosphatidylinositol (GPI) anchor of target proteins: removes the GPI-anchor of RECK, leading to RECK release from the plasma membrane. May contribute to the osmotic regulation of cellular glycerophosphocholine.
Gene References Into Functions
  1. GDE2 is crucial for neuronal survival in the postnatal mammalian spinal cord. PMID: 28103900
  2. Posttranslational modifications increase glycerophosphocholine by inhibiting GDPD5 phosphodiesterase. PMID: 23589856
  3. Gde2 plays a key role in controlling cortical neuronal fates by regulating the timing of neurogenesis. Loss of Gde2 reveals additional mechanisms that trigger remaining neuronal progenitors to differentiate at the end of the neurogenic period. PMID: 22951639
  4. Evidence suggests that neuronal GDE2 controls motor neuron subtype diversity through a non-cell-autonomous feedback mechanism that directly regulates progenitor cell differentiation. PMID: 21943603
  5. These findings demonstrate that GDE2 expression during neuronal differentiation is essential for growing neurites. PMID: 17275818
  6. GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte glycerophosphocholine. PMID: 18667693
  7. Studies have identified the antioxidant enzyme Prdx1 as an interactor of GDE2 and uncovered a developmental role for Prdx1 in regulating neuronal differentiation in the spinal cord. PMID: 19766572

Show More

Hide All

Database Links
Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cell projection, growth cone.
Tissue Specificity
Detected in brain, lung, heart, kidney and testis.

Q&A

What is GDPD5 and what is its primary enzymatic function?

GDPD5 (Glycerophosphodiester phosphodiesterase domain-containing protein 5) functions primarily as a glycerophosphocholine phosphodiesterase (GPC-PDE) that catalyzes the hydrolysis of glycerophosphocholine (GPC) in cellular systems. This enzyme belongs to a family originally identified in bacterial genes and plays crucial roles in phospholipid metabolism pathways .

Functionally, GDPD5 contributes to the regulation of GPC abundance within cells. Experimental evidence demonstrates that when recombinant GDPD5 is immunoprecipitated from HEK293 cells and examined in vitro, it exhibits significant GPC-PDE activity compared to control immunoprecipitates from cells transfected with empty vectors . This enzymatic activity directly impacts cellular GPC levels, with knockdown and overexpression studies confirming its role in GPC regulation.

What is the subcellular localization of GDPD5?

GDPD5 predominantly localizes to the perinuclear region in mammalian cells. When recombinant GDPD5 tagged with V5 epitope is expressed in HEK293 cells, immunofluorescence microscopy reveals a distinct perinuclear distribution pattern . This localization is consistent across different cell types, including mIMCD3 cells.

The protein contains seven putative transmembrane domains, consistent with its membrane localization. Co-localization studies with neuropathy target esterase (NTE), a known endoplasmic reticulum (ER) protein, confirm that GDPD5 resides primarily in the ER . This ER localization suggests GDPD5 may coordinate with other ER-resident enzymes to regulate phosphatidylcholine (PC) homeostasis, although direct protein-protein interactions (such as co-immunoprecipitation with NTE) have not been observed.

What is the tissue distribution and expression pattern of GDPD5?

GDPD5 exhibits a tissue-specific expression pattern with enrichment in neural tissues. It is predominantly expressed in:

  • Neurons

  • Terminally differentiated oligodendrocyte subsets

  • Vascular endothelium

This distribution pattern aligns with GDPD5's critical functions in neuronal differentiation, growth, and survival . In experimental models, GDPD5 expression has been detected in mouse inner medullary collecting duct (mIMCD3) cells, indicating its presence in renal tissues as well .

What are the optimal methods for measuring GDPD5 enzymatic activity?

GDPD5 enzymatic activity can be reliably measured using a combination of recombinant protein expression, immunoprecipitation, and in vitro activity assays. A validated experimental workflow includes:

  • Protein Expression: Transfect HEK293 cells with recombinant GDPD5-V5 expression vector

  • Protein Isolation: Immunoprecipitate the recombinant protein using anti-V5 antibodies

  • Activity Assay: Incubate the immunoprecipitate with GPC substrate and measure hydrolysis products

The resultant GPC-PDE activity can be quantified and compared to control immunoprecipitates from cells transfected with empty vector . This methodology provides a reliable assessment of GDPD5 enzymatic function.

Critical controls should include:

  • Empty vector transfection control

  • Substrate specificity controls

  • Assessment of enzymatic activity under varying osmotic conditions

How can I manipulate GDPD5 expression in cellular models?

Reliable manipulation of GDPD5 expression levels can be achieved through several established techniques:

Knockdown Approaches:

siRNA-mediated knockdown has been successfully employed in mIMCD3 cells, achieving approximately 55% reduction in GDPD5 expression. This approach resulted in a measurable 60% increase in cellular GPC levels .

Recommended Protocol:

  • Transiently transfect cells with specific siRNA targeting GDPD5

  • Use scrambled siRNA as negative control

  • Confirm knockdown efficiency via RT-PCR or Western blot

  • Measure functional outcomes (GPC levels, cellular phenotypes)

Overexpression Approaches:

Recombinant GDPD5 overexpression has been validated in multiple cell lines, including HEK293 and SH-SY5Y neuroblastoma cells .

Recommended Protocol:

  • Clone mouse GDPD5 cDNA into appropriate expression vector (with epitope tag for detection)

  • Transfect target cells using optimized transfection protocols

  • Verify overexpression via Western blot or immunofluorescence

  • Assess functional outcomes (GPC-PDE activity, GPC levels, cellular phenotypes)

Overexpression of recombinant GDPD5 typically increases GPC-PDE activity by approximately 50% while decreasing cellular GPC levels by about 30% .

How is GDPD5 expression regulated by osmotic stress?

GDPD5 expression demonstrates significant sensitivity to osmotic conditions, with a complex pattern of regulation:

Osmotic ConditionEffect on GDPD5 mRNAMechanismEffect on GDPD5 Activity
Normal (300 mosmol/kg)Baseline expression-Normal activity
High NaClDecreased abundanceIncreased mRNA degradation rateReduced activity
High ureaNo change in abundanceNo effect on mRNA stabilityReduced activity
Combined NaCl + urea (700 mosmol/kg)Reduced expressionMultiple mechanismsReduced activity

When cells are exposed to hyperosmotic conditions through the addition of NaCl (200 mosmol/kg) and urea (200 mosmol/kg), GDPD5 expression is significantly reduced . This regulation appears to be mediated primarily through post-transcriptional mechanisms, particularly increased degradation of GDPD5 mRNA in high NaCl conditions.

Interestingly, while high urea does not affect GDPD5 mRNA abundance, it does reduce the enzymatic activity of the protein when measured in vitro . This suggests multiple layers of regulation involving both gene expression and post-translational modifications affecting protein function.

What is the relationship between GDPD5 and lipid metabolism?

GDPD5 plays a significant role in lipid metabolism through several mechanisms:

  • GPC Regulation: GDPD5 directly regulates cellular GPC levels through its GPC-PDE activity. Knocking down GDPD5 increases cellular GPC, while overexpression reduces it .

  • Impact on Lipogenic Enzymes: Overexpression of GDPD5 in SH-SY5Y neuroblastoma cells results in reduced expression of acetyl-coenzyme A carboxylase (ACC), a key enzyme in fatty acid synthesis .

  • Selective Metabolic Effects: While GDPD5 affects ACC levels, it does not significantly alter other metabolic enzymes such as ACLY, HADH and PPARA, suggesting a selective role in specific lipid metabolism pathways .

The metabolic functions of GDPD5 appear particularly important in neural tissues, where proper lipid composition is critical for membrane function, signaling, and cellular development.

How does GDPD5 contribute to neuronal development and function?

GDPD5 has emerged as a critical factor in neuronal biology through several mechanisms:

  • Neuronal Differentiation: GDPD5 promotes differentiation of neuronal cells, including neuroblastoma cells, potentially through the release of glypican .

  • Growth and Survival: GDPD5 expression is linked to neuronal growth and survival mechanisms, making it an essential component in neural development .

  • Membrane Composition: By regulating GPC levels and lipid metabolism, GDPD5 likely influences membrane composition in developing neurons, which is critical for proper cellular function.

The precise molecular mechanisms underlying these roles remain under investigation, but the importance of GDPD5 in neural systems is well-established through expression studies and functional analyses.

What role does GDPD5 play in neuroblastoma (NB)?

GDPD5 demonstrates significant associations with neuroblastoma progression and patient outcomes:

  • Prognostic Value: GDPD5 has been identified as an independent prognostic factor for neuroblastoma, along with ACHE and PIK3R1 . These three genes form a prognostic signature with the following risk score formula:

    Risk Score = ACHE×0.862854240578636 + GDPD5×0.777001638391889 + PIK3R1×0.646763659363925

  • Risk Stratification: This prognostic model effectively distinguishes between high-risk and non-high-risk neuroblastoma patients with high accuracy. Using optimal cutoff values, this model identifies high-risk children with 85.23% accuracy and non-high-risk children with 93.48% accuracy .

  • Functional Effects: Experimental studies in SH-SY5Y neuroblastoma cells demonstrate that GDPD5 overexpression inhibits cell proliferation and migration, suggesting a tumor-suppressive function .

  • Lipid Metabolism Connection: GDPD5's effects on neuroblastoma cells appear to be partially mediated through alterations in lipid metabolism, particularly through the reduction of ACC expression .

How is GDPD5 regulated by microRNAs in disease contexts?

MicroRNA regulation of GDPD5 represents an important post-transcriptional control mechanism, particularly in disease settings:

  • Potential miRNA Regulators: Bioinformatic analyses have identified several microRNAs that potentially target GDPD5, including hsa-miR-592 .

  • Clinical Correlations: Among the predicted GDPD5-targeting miRNAs, hsa-miR-592 shows particular relevance in neuroblastoma. Kaplan-Meier analysis demonstrates that hsa-miR-592 expression effectively distinguishes between high-risk and low-risk neuroblastoma patients .

  • Expression Pattern: The inverse expression pattern between GDPD5 and certain miRNAs in high-risk versus low-risk patients supports the hypothesis of miRNA-mediated regulation. GDPD5 is downregulated in high-risk patients, while miRNAs that silence mRNAs generally show opposite expression patterns .

This regulatory mechanism provides insight into potential therapeutic approaches targeting the miRNA-GDPD5 axis in neuroblastoma and potentially other diseases.

What experimental controls should be included when studying GDPD5 function?

Rigorous experimental design for GDPD5 studies should incorporate several critical controls:

  • Expression Controls:

    • Empty vector transfection controls for overexpression studies

    • Scrambled siRNA controls for knockdown experiments

    • Validation of expression changes at both mRNA and protein levels

  • Activity Assays:

    • Include enzyme-free or heat-inactivated enzyme controls

    • Validate substrate specificity with structurally related compounds

    • Include positive control enzymes with known GPC-PDE activity

  • Osmotic Condition Controls:

    • Monitor and control osmolality precisely in all experiments

    • Include both NaCl and urea conditions separately to distinguish ionic vs. non-ionic osmotic effects

    • Consider time-course experiments to distinguish acute vs. chronic osmotic effects

  • Subcellular Localization:

    • Use multiple subcellular markers for colocalization studies

    • Include both N- and C-terminally tagged constructs to rule out tag interference

    • Validate localization in multiple cell types

  • Disease Model Validation:

    • Correlate in vitro findings with patient-derived samples

    • Validate prognostic signatures in independent patient cohorts

    • Consider both gain- and loss-of-function approaches in disease models

How can I troubleshoot inconsistent GDPD5 activity measurements?

When encountering variability in GDPD5 activity assays, consider the following troubleshooting approaches:

  • Protein Expression and Stability:

    • Verify consistent expression levels across experiments

    • Assess protein stability under your experimental conditions

    • Consider adding protease inhibitors during sample preparation

  • Osmotic Sensitivity:

    • GDPD5 activity is known to be reduced when exposed to high NaCl or urea conditions

    • Standardize and carefully control buffer osmolality

    • Document the osmotic history of the cells used for GDPD5 isolation

  • Post-translational Modifications:

    • Consider potential phosphorylation or other modifications affecting activity

    • Evaluate the effects of phosphatase inhibitors in your preparations

    • Examine activity under different cellular signaling conditions

  • Substrate Quality and Concentration:

    • Ensure consistent substrate quality and preparation

    • Perform enzyme kinetics to determine optimal substrate concentrations

    • Consider potential substrate or product inhibition effects

  • Detection Method Sensitivity:

    • Validate the linear range of your detection system

    • Include internal standards for normalization

    • Consider alternative detection methodologies with improved sensitivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.