Recombinant Mouse Glycosylphosphatidylinositol anchor attachment 1 protein (Gpaa1)

Shipped with Ice Packs
In Stock

Description

Functional Role in GPI Anchoring

Gpaa1 is a core subunit of the GPI transamidase complex, which catalyzes the transfer of pre-assembled GPI anchors to target proteins in the endoplasmic reticulum (ER). Key steps include:

  1. Recognition of GPI Attachment Signals: Gpaa1 interacts with components like PIGT and PIGK to identify C-terminal GPI attachment signals .

  2. Carbonyl Intermediate Formation: The complex forms a covalent intermediate, enabling efficient GPI transfer .

  3. Membrane Protein Anchoring: Anchored proteins are then trafficked to the Golgi and plasma membrane .

Interactions with Other Proteins

Gpaa1 collaborates with multiple proteins in the GPI transamidase complex:

Partner ProteinFunctionInteraction Evidence
PIGTCatalyzes GPI transfer via carbonyl intermediate formation
PIGSStabilizes the transamidase complex and substrate recognition
PIGUBinds GPI attachment signals or lipid components
PIGKMediates GPI anchoring in the ER; forms peptidase C13 family intermediates

These interactions highlight Gpaa1’s role in substrate recognition and complex assembly .

4.1. Cancer Progression

  • Hepatocellular Carcinoma (HCC): Gpaa1 overexpression correlates with enhanced proliferation, migration, and invasion. Silencing Gpaa1 in HuH-7 cells reduces colony formation and metastasis .

  • Tumor Immune Evasion: Gpaa1 knockout in ovarian cancer cells abolishes CD24 surface expression, increasing phagocytosis by tumor-associated macrophages (TAMs) and suppressing tumor growth in mice .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this need to us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpaa1; Gaa1; Glycosylphosphatidylinositol anchor attachment 1 protein; GPI anchor attachment protein 1; GAA1 protein homolog; mGAA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-621
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
GLLSDPVRRRALARIVLRLNTPLCVLSYVAGIAWFLALAFPPLTQRTYMSENAMGSTMVE EQFVGGDRARSFARDFAAHRKKPGALPVAWLERSMRSVGLEVYTQSFSRKLPFPDETHER YMVSGTNVYGILRAPRSASTESLVLTVPCGPDATNSQAVGLLLALAAHFRGQIYWAKDII FLVTDHDLLGTEAWLEAYHDINVTGIQSSPLQGRAGAIQAAVALELSSDVVTSLDVTVEG LNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPQDWTSLEGPLQGLQTLLLMVLRQASGR PHGPHGLFLRYGVEALTLRGINSFRQYKYDLATVGKALEGMFRKLNHLLERLHQSFFFYL LPALSRFVSIGLYMPATGFLLLVLGLKALELWMQLHQAGVNPEEAGKAPSPGTPLLPTQG VGLASLTAPLLISQAMGLALYFLPVLGQHLATQHFPVAEAEAVVLTLLAIYVAGLALPHN THRVVNSQVPDRGWMALKLVALIYLALQLGCIALLNFSLGFLLAATMVPAAALAKPHGPR TLYAALLVVTSPAVTLFGSLFLWRELLEVPLSLAEGWQLFLTALAQGVLEHYTYGALLFP ILALGLYPCWLLFWNVLFWK
Uniprot No.

Target Background

Function
Essential for GPI-anchoring of precursor proteins, but not for GPI synthesis. It functions before or during the formation of the carbonyl intermediate.
Gene References Into Functions
  1. A conserved proline within the last transmembrane segment of Gaa1 is crucial for glycosylphosphatidylinositol recognition by GPI transamidase. PMID: 14660601
Database Links

KEGG: mmu:14731

STRING: 10090.ENSMUSP00000023221

UniGene: Mm.5903

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed in fetal and adult tissues. Expressed at higher levels in fetal tissues than adult tissues. In embryos abundant in the choroid plexus, skeletal muscle,.

Q&A

What is Gpaa1 and what is its primary function in mammalian cells?

Gpaa1 (Glycosylphosphatidylinositol anchor attachment 1 protein) is a critical component of the GPI transamidase complex that facilitates the attachment of GPI anchors to proteins in the endoplasmic reticulum. This post-translational modification is essential for targeting proteins to the plasma membrane. Specifically, Gpaa1 participates in the attachment process whereby the GPI moiety is transferred to proteins that contain a GPI-attachment signal sequence. The protein functions within a multi-subunit complex in the endoplasmic reticulum membrane, where it interacts with other transamidase components to facilitate this critical cellular process. This modification is fundamental for the localization and function of numerous cell surface proteins involved in signal transduction, cell adhesion, and other essential cellular processes .

What techniques are recommended for detecting endogenous Gpaa1 expression in mouse tissues?

For robust detection of endogenous Gpaa1 in mouse tissues, researchers should employ multiple complementary techniques. Quantitative RT-PCR using primers specific to mouse Gpaa1 provides sensitive measurement of mRNA expression levels across different tissues. Western blotting with validated anti-Gpaa1 antibodies can quantify protein expression, though careful optimization of lysis conditions is required due to Gpaa1's membrane association. Immunohistochemistry or immunofluorescence microscopy enables visualization of Gpaa1's subcellular localization, typically showing ER membrane patterns. For functional assessment of GPI anchoring activity, flow cytometry analysis of GPI-anchored proteins on cell surfaces serves as an indirect but functional readout of Gpaa1 activity. This approach has been successfully utilized in studies of GPAA1 variants, confirming deficiency of several GPI-anchored proteins on leukocytes .

What are the optimal expression systems for producing functional recombinant mouse Gpaa1?

For producing functional recombinant mouse Gpaa1, mammalian expression systems are strongly preferred over bacterial systems due to the protein's complex membrane topology and post-translational modifications. HEK293 or CHO cell lines transfected with expression vectors containing the mouse Gpaa1 coding sequence with appropriate epitope tags (His, FLAG, or HA) typically yield the most functional protein. These systems provide the necessary cellular machinery for proper folding, membrane insertion, and assembly with other transamidase complex components.

When designing expression constructs, researchers should consider including:

  • TEV protease cleavage sites for tag removal

  • Signal peptide sequences to ensure proper ER targeting

  • Codon optimization for mammalian expression

Baculovirus expression systems represent an alternative approach that can achieve higher yields while maintaining proper protein folding. For functional studies, co-expression with other transamidase complex components may be necessary to reconstitute the entire functional complex. Protein purification requires careful optimization of detergent conditions to maintain the native conformation of this membrane-associated protein .

How can flow cytometry be optimized for assessing GPI-anchored protein deficiency in Gpaa1-modified models?

Flow cytometry provides a powerful approach for functional assessment of Gpaa1 activity through detection of GPI-anchored proteins on cell surfaces. For optimal protocol design:

  • Select appropriate GPI-anchored protein markers: Include CD16, CD59, and alkaline phosphatase, as these have been successfully used to confirm GPI anchoring deficiencies in GPAA1-variant studies .

  • Use multi-color panel design: Incorporate antibodies against 3-5 different GPI-anchored proteins labeled with distinct fluorophores to provide comprehensive assessment of anchoring defects.

  • Include non-GPI anchored membrane proteins as controls: These distinguish between specific GPI anchoring defects and general membrane protein trafficking issues.

  • Analyze multiple cell lineages: Different cell types may show variable sensitivity to Gpaa1 deficiency; examine both lymphoid and myeloid populations when using hematopoietic cells.

  • Quantitative analysis: Report mean fluorescence intensity ratios compared to wild-type controls rather than simple positive/negative classifications.

This approach has proven effective in clinical studies where flow cytometry confirmed deficiency of several GPI-anchored proteins on leukocytes in patients with biallelic GPAA1 variants, providing a functional readout that correlated with clinical phenotypes .

What knockdown/knockout approaches are most effective for studying Gpaa1 function in mouse models?

When investigating Gpaa1 function through loss-of-function approaches, researchers should consider the following methods based on experimental objectives:

For transient knockdown:

  • siRNA transfection provides rapid but short-term Gpaa1 reduction (3-5 days) suitable for acute assays in cultured cells.

  • shRNA lentiviral transduction offers more sustained knockdown for longer experiments (weeks) and can be used in harder-to-transfect cell types.

For stable genetic models:

  • CRISPR-Cas9 gene editing can generate complete knockouts or specific point mutations that mirror disease-associated variants.

  • Conditional knockout systems (Cre-loxP) are essential when studying Gpaa1 in developmental contexts, as complete knockout may be embryonically lethal.

Each approach requires validation using multiple methods:

  • qRT-PCR to confirm mRNA reduction

  • Western blotting to verify protein depletion

  • Flow cytometry to evaluate functional consequences through measurement of GPI-anchored proteins

Studies have demonstrated that GPAA1 knockdown markedly inhibits proliferation, migration, and invasion capabilities in cancer cell lines, suggesting similar approaches would be valuable in mouse models of disease .

How does Gpaa1 contribute to cancer progression in mouse models?

Gpaa1 plays significant roles in cancer progression through multiple mechanisms that can be investigated in mouse models. Research has demonstrated that GPAA1 is overexpressed in hepatocellular carcinoma (HCC) and acute lymphoblastic leukemia (ALL), with strong correlations to disease progression . In experimental models, GPAA1 knockdown markedly inhibits proliferation, migration, and invasion capabilities of cancer cells, accompanied by reduced levels of matrix metalloproteinases MMP2 and MMP9 .

The oncogenic mechanisms of Gpaa1 include:

  • Regulation of c-myc expression, as demonstrated in ALL models where GPAA1 promotes leukemia progression through this pathway

  • Interaction with splicing factor SF3B4, which appears to promote HCC cell proliferation, invasion and migration through GPAA1 binding

  • Potential alteration of cell surface GPI-anchored proteins involved in signal transduction

Mouse models with tissue-specific Gpaa1 overexpression or targeted knockout in cancer-prone backgrounds would be valuable for elucidating these mechanisms in vivo. When designing such models, researchers should incorporate markers for proliferation, invasion, and metastasis to fully characterize phenotypic effects .

What is known about Gpaa1 mutations and neurodevelopmental phenotypes?

Gpaa1 mutations have significant implications for neurodevelopment, with clinical research on GPAA1 variants providing critical insights that can inform mouse model design. Studies of patients with biallelic GPAA1 variants reveal a constellation of neurological phenotypes including developmental delay, seizures, hypotonia, and cerebellar anomalies . Flow cytometry analysis of patient samples has confirmed deficiency of GPI-anchored proteins on leukocytes, establishing the functional consequence of these mutations .

Key considerations for investigating neurodevelopmental phenotypes in Gpaa1 mouse models:

  • Cerebellar development: Neuroimaging revealed cerebellar anomalies in the majority of patients with GPAA1 variants, suggesting Gpaa1 plays a critical role in cerebellar development .

  • Seizure activity: EEG monitoring in Gpaa1-deficient mice would be valuable, as seizures are a common clinical feature.

  • Motor function assessment: Hypotonia and developmental delay suggest motor deficits that can be measured using standardized tests in mouse models.

  • CNS glycosylphosphatidylinositol deficiency: Mouse models have shown that CNS GPI deficiency results in delayed white matter development, ataxia, and premature death .

  • Alkaline phosphatase levels: Monitor these as a biomarker, though clinical data shows variability with normal levels in most patients despite clear GPI anchoring defects .

Mouse models carrying specific Gpaa1 mutations corresponding to human disease variants would be particularly valuable for translational research in this area .

How does Gpaa1 interact with other components of the GPI transamidase complex?

Gpaa1 functions as an integral component of the GPI transamidase complex, a multi-subunit machinery responsible for attaching GPI anchors to proteins in the endoplasmic reticulum. Understanding these interactions is crucial for interpreting experimental results with recombinant Gpaa1.

The GPI transamidase complex consists of five known subunits, with Gpaa1 serving as the catalytic component that facilitates the attachment of the GPI anchor to the C-terminus of target proteins after cleavage of the GPI attachment signal sequence. This process involves:

  • Recognition of the GPI attachment signal sequence in target proteins.

  • Cleavage of this signal sequence by the transamidase activity.

  • Formation of an amide bond between the newly exposed C-terminus and the amino group of the GPI anchor.

Gpaa1 contains transmembrane domains that anchor it in the ER membrane and contributes to substrate recognition and catalytic activity. Co-immunoprecipitation studies would be valuable for mapping the precise interactions between Gpaa1 and other complex components. When designing recombinant Gpaa1 constructs, researchers should consider that truncation or mutation of key domains may disrupt these protein-protein interactions and impair functional activity .

What experimental designs best elucidate the differential expression of Gpaa1 in various cancer types?

To comprehensively investigate Gpaa1 differential expression across cancer types, researchers should implement multi-layered experimental designs that integrate genomic, transcriptomic, and proteomic approaches:

  • Genomic analysis:

    • Comparative genomic hybridization to detect GPAA1 gene amplification, which has been associated with hepatocellular carcinoma

    • Next-generation sequencing to identify potential driver mutations or copy number variations

  • Transcriptomic profiling:

    • RNA-Seq analysis comparing tumor vs. matched normal tissues across multiple cancer types

    • Single-cell RNA-Seq to identify cell populations with elevated Gpaa1 expression within heterogeneous tumors

  • Protein expression:

    • Tissue microarray immunohistochemistry using validated anti-Gpaa1 antibodies

    • Quantitative proteomics using mass spectrometry

  • Functional correlation:

    • Integration of Gpaa1 expression data with clinical outcomes and tumor characteristics

    • Analysis of GPI-anchored protein profiles on cancer cells using flow cytometry

Evidence suggests significant variability in GPAA1's role across cancer types. In hepatocellular carcinoma, GPAA1 is overexpressed and associated with gene amplification, while in acute lymphoblastic leukemia, GPAA1 promotes progression through c-myc regulation . These findings highlight the importance of tissue-specific analysis when investigating Gpaa1 in cancer models .

How can recombinant mouse Gpaa1 be used to screen for small molecule modulators of GPI anchoring?

Developing a robust screening platform using recombinant mouse Gpaa1 for identifying small molecule modulators requires careful assay design:

  • Reconstituted in vitro system:

    • Express and purify recombinant mouse Gpaa1 along with other transamidase complex components

    • Establish a cell-free GPI anchoring assay using fluorescently labeled substrate proteins containing GPI attachment signals

    • Measure transamidase activity through FRET-based detection of successful GPI attachment

  • Cell-based screening approaches:

    • Generate stable cell lines expressing recombinant mouse Gpaa1 fused to split luciferase or other reporter systems

    • Develop flow cytometry-based measurements of GPI-anchored protein expression as functional readouts

    • Implement high-content imaging to monitor subcellular localization of GPI-anchored reporters

  • Validation strategies:

    • Secondary assays to confirm on-target activity including direct binding measurements (SPR, MST)

    • Counter-screens against human GPAA1 to assess species selectivity

    • Structural analysis of Gpaa1-compound interactions using hydrogen-deuterium exchange mass spectrometry

Given that GPI anchoring deficiencies lead to developmental delays, seizures, and other neurological abnormalities, small molecule modulators identified through such screens could have therapeutic potential for conditions associated with GPI anchoring dysregulation .

What approaches can resolve the contradictory data on Gpaa1's role in different disease contexts?

Resolving seemingly contradictory findings regarding Gpaa1's role across different disease contexts requires systematic experimental approaches that account for tissue-specificity, developmental timing, and molecular context:

  • Context-dependent protein interactions:

    • Comparative interactome analysis using BioID or proximity labeling approaches in different cell types

    • Investigation of tissue-specific binding partners, such as the interaction between GPAA1 and SF3B4 observed in hepatocellular carcinoma

    • Analysis of post-translational modifications that may differ between tissues

  • Temporal dynamics:

    • Inducible expression systems to study acute versus chronic effects of Gpaa1 modulation

    • Developmental stage-specific knockout/knockdown to identify critical windows for Gpaa1 function

  • Substrate specificity:

    • Comprehensive profiling of GPI-anchored proteins across tissues using proteomics

    • Analysis of substrate preferences in different cell types may reveal why certain tissues are more affected by Gpaa1 mutations

  • Pathway integration:

    • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data

    • Investigation of compensatory mechanisms that may be active in certain contexts

While GPAA1 shows oncogenic properties in hepatocellular carcinoma and acute lymphoblastic leukemia, its deficiency causes severe developmental abnormalities . These seemingly contradictory roles likely reflect Gpaa1's fundamental function in GPI anchoring affecting different downstream pathways depending on cellular context and developmental stage .

What are the critical quality control parameters for recombinant mouse Gpaa1 protein preparations?

Ensuring high-quality recombinant mouse Gpaa1 protein preparations requires rigorous quality control assessments across multiple parameters:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity recommended)

    • Mass spectrometry to confirm identity and detect potential contaminants or truncations

    • Size exclusion chromatography to evaluate aggregation state

  • Structural integrity:

    • Circular dichroism to assess secondary structure content

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to confirm proper folding

  • Functional validation:

    • In vitro GPI transamidase activity assay using fluorescently labeled substrate peptides

    • Binding assays to confirm interaction with known partners in the transamidase complex

    • Flow cytometry to verify restoration of GPI-anchored protein expression when introduced into Gpaa1-deficient cells

  • Membrane incorporation:

    • Liposome reconstitution efficiency

    • Proper orientation in membrane mimetics (determined by protease protection assays)

These quality control measures are essential because functional defects in GPAA1 lead to significant clinical manifestations, including developmental delay, seizures, and cerebellar anomalies, highlighting the protein's critical biological role . Additionally, since GPAA1 has been implicated in cancer progression, ensuring consistent protein quality is crucial for developing reliable experimental models .

How can researchers optimize co-expression systems for studying Gpaa1 interactions with transamidase complex components?

Optimizing co-expression systems for studying Gpaa1 within the context of the complete transamidase complex requires strategic experimental design:

  • Vector design considerations:

    • Multi-cistronic vectors with varying promoter strengths to achieve physiologically relevant stoichiometry

    • Differential epitope tags (FLAG, HA, His, etc.) on each component to enable selective purification and detection

    • Fluorescent protein fusions for subsets of experiments to visualize complex formation

  • Expression system selection:

    • Mammalian cells (HEK293, CHO) provide proper folding environment and ER membrane structure

    • Baculovirus-insect cell systems offer higher yield while maintaining eukaryotic processing

    • Cell-free expression systems with supplemented microsomes for rapid prototyping

  • Validation approaches:

    • Blue native PAGE to assess intact complex formation

    • Sequential co-immunoprecipitation to confirm multi-component interactions

    • Fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) to monitor protein-protein interactions in living cells

  • Functional assessment:

    • Flow cytometry analysis of GPI-anchored protein expression as a functional readout

    • In vitro reconstitution of GPI transamidase activity using purified complexes

This systematic approach facilitates investigation of how Gpaa1 interacts with other transamidase components, which is crucial for understanding the molecular basis of GPI anchoring deficiencies and their associated phenotypes, including developmental delay, hypotonia, and cerebellar anomalies observed in patients with GPAA1 variants .

What are the best practices for designing mouse models to study Gpaa1 function in vivo?

Designing mouse models to study Gpaa1 function requires careful consideration of several critical factors to ensure physiological relevance and interpretable results:

  • Model selection strategy:

    • Constitutional knockout approaches may result in embryonic lethality due to Gpaa1's essential function

    • Conditional knockout models using tissue-specific Cre recombinase expression provide targeted analysis

    • Knock-in models carrying specific patient mutations offer translational relevance for studying pathological mechanisms

  • Design considerations:

    • Include LoxP sites flanking critical exons to enable conditional deletion

    • Incorporate reporter genes (LacZ, GFP) to track expression patterns

    • Design point mutations that precisely mimic human disease variants

  • Phenotypic analysis framework:

    • Comprehensive neurological assessment, including seizure susceptibility, motor coordination, and cerebellar development

    • Flow cytometry analysis of GPI-anchored proteins on multiple cell types

    • Tissue-specific analysis for cancer models focusing on proliferation, invasion markers

  • Controls and validation:

    • Include littermate controls with matching genetic background

    • Validate Gpaa1 deletion/mutation at DNA, RNA, and protein levels

    • Confirm functional consequences through assessment of GPI-anchored protein expression

Research has shown that GPAA1 variants are associated with developmental delay, seizures, cerebellar anomalies, and other neurological manifestations . Additionally, CNS-specific GPI deficiency in mouse models results in delayed white matter development, ataxia, and premature death, highlighting the importance of neurological assessment in these models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.