Recombinant Mouse GPI transamidase component PIG-S (Pigs)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems:

  • Cell-Free Expression: Systems yield ≥85% purity, ideal for biochemical studies .

  • Host-Dependent Systems:

    • E. coli, yeast, baculovirus, or mammalian cells are used for partial recombinant protein production .

Functional Studies:

  • GPI Transamidase Complex Analysis: Used to dissect interactions between PIG-S, PIG-T, GAA1, and GPI8 via co-immunoprecipitation .

  • Knockout Models: Mouse F9 PIG-S knockout cells show abolished GPI-anchored protein expression (e.g., Thy-1), reversible via cDNA transfection .

Biochemical Tools:

  • Control Fragments: Recombinant fragments (e.g., aa 372–517) serve as blocking controls in antibody validation .

  • Enzyme Activity Assays: Used to study GPI transamidase kinetics and inhibition mechanisms .

Comparative Insights

Orthologs and Homologs:

  • Human PIG-S shares 92% sequence identity with mouse PIG-S .

  • Yeast orthologs (GPI16 and GPI17) are structurally conserved, emphasizing evolutionary importance .

Species-Specific Variations:

  • Murine PIG-S lacks N-terminal methionine in mature forms, suggesting cytoplasmic orientation .

Key Research Findings

  • Complex Stability: PIG-T stabilizes GPI transamidase by maintaining GAA1 and GPI8 expression .

  • Defective Transfer: PIG-S knockout cells accumulate GPI precursors (H5, H6, H7, H8) but fail to attach GPI to proteins .

  • Therapeutic Relevance: Mutations in PIG-S homologs are linked to GPI deficiency disorders, highlighting its biomedical significance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Pigs; GPI transamidase component PIG-S; Phosphatidylinositol-glycan biosynthesis class S protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-555
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AAAGAAATDLEVVRGKRSALFFAAVAILLGLPLWWKTTETYRAPLPYSDISGLNALLLRL MVPVTVVFTRDSVPLDDQEKLPFTVVHEREIPLKYKMKIKCRFQKAYRRALEHEEEALSL GSVHEAEAMLAEPEKQAEGSLTVYVISEHSSLLPQDMMSYIGPERTAVVRGLIHREAFNI IGRRIVQVAQAMSLTEDVLAAALADHLPEDKWSSDKRRPLKSSLGYEITFSLLNPDPKSH DVHWDIEGAVQRFVQPFLNRLSVAGNFSVDSQILYYAMLGVNPRFDPASSSYSLAMHSLP HVINPVESRLGSSAASLYPVLHFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMV YNVDPKIYNASELPVRVEVDMVRVMEVFLAQLRLLFGIAQPQVPPKCLLSGPKSEGLMTW ELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYRAVAAVQKAAKALAL GHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIF QETRKSWKKPEKID
Uniprot No.

Target Background

Function
Component of the GPI transamidase complex. Essential for the transfer of GPI to proteins, particularly for the formation of carbonyl intermediates.
Database Links
Protein Families
PIGS family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is PIG-S and what role does it play in GPI anchor attachment?

PIG-S is an essential component of the GPI transamidase complex, which mediates the attachment of GPI anchors to proteins in the endoplasmic reticulum (ER). The GPI transamidase functions by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this process, the GPI transamidase forms a carbonyl intermediate with the substrate protein. PIG-S works alongside other components including GAA1, GPI8, and PIG-T to facilitate this critical post-translational modification .

The importance of PIG-S has been demonstrated through gene disruption studies in mouse F9 cells, where PIG-S knockout resulted in cells unable to express GPI-anchored proteins on their surface, despite normal synthesis of GPI precursors .

What is the molecular structure of mouse PIG-S?

Human PIG-S consists of 555 amino acids with two transmembrane domains positioned near the N- and C-termini. The mouse homolog shares significant structural similarities. Based on protein expression studies, the absence of an N-terminal methionine in expressed PIG-S protein suggests a cytoplasmic orientation for the N-terminus, with the large hydrophilic region in the middle of the molecule being luminally oriented in the ER .

PIG-S has a similar structure across species, with homologs found in:

  • Saccharomyces cerevisiae (534 amino acids, 23% identity with human)

  • Schizosaccharomyces pombe (554 amino acids, 27% identity with human)

  • Drosophila melanogaster

  • Caenorhabditis elegans

How does PIG-S interact with other components of the GPI transamidase complex?

PIG-S forms a protein complex with GAA1, GPI8, and PIG-T. This complex association is critical for the GPI transamidase function. Immunoprecipitation and affinity purification studies have revealed that these components form an NP-40-resistant complex. The complex was initially identified through a two-step affinity purification process using GST-tagged human GPI8, which demonstrated four bands with comparable intensities at positions 60-70 kDa when analyzed by SDS-PAGE .

Functional studies indicate that PIG-T has a particularly important role in maintaining the stability of this complex. The precise molecular interactions between these components are still being elucidated, but it's clear that all components are essential for the formation of carbonyl intermediates during the transamidation reaction .

What experimental approaches are used to study PIG-S function in mouse models?

Researchers typically employ gene disruption methods through homologous recombination to study PIG-S function in mouse models. In the studies cited, investigators disrupted the PIG-S gene in F9 embryonal carcinoma cells by replacing a region including the exon containing the initiation codon with a drug resistance gene .

The knockout is typically verified through:

  • Southern blot analysis to confirm the disappearance of wild-type alleles and appearance of mutant alleles

  • Flow cytometry to assess surface expression of GPI-anchored proteins such as Thy-1

  • Metabolic labeling with [³H]mannose followed by thin-layer chromatography (TLC) to analyze GPI synthesis and accumulation

These approaches allow researchers to demonstrate that while PIG-S knockout cells can synthesize and accumulate mature forms of GPI (H7 and H8) and their precursors (H5 and H6), they cannot attach these GPI anchors to proteins, confirming PIG-S's essential role in the attachment process rather than GPI synthesis .

How do PIG-S mutations affect GPI-anchored protein expression patterns?

PIG-S mutations lead to a complete block in GPI anchor attachment to proteins, resulting in the absence of GPI-anchored proteins on the cell surface. This has been demonstrated in PIG-S knockout F9 cells, which failed to express Thy-1 (a GPI-anchored protein) on their surface. Expression was restored by transfection with the corresponding PIG-S cDNA, confirming the specificity of the effect .

The absence of GPI-anchored proteins due to PIG-S mutations results in:

  • Accumulation of mature forms of GPI (H7 and H8) and their precursors (H5 and H6)

  • Complete loss of cell surface expression of GPI-anchored proteins

  • Potential disruption of cell signaling pathways dependent on GPI-anchored proteins

These expression pattern changes provide a clear phenotypic marker for identifying PIG-S mutations and assessing the efficiency of rescue experiments.

How conserved is PIG-S across different species, and what does this tell us about its evolutionary importance?

PIG-S shows significant conservation across species, indicating its fundamental evolutionary importance in eukaryotic cells. The amino acid identity percentages between species reveal the degree of conservation:

SpeciesAmino Acid LengthIdentity with Human PIG-S
Human555100%
S. cerevisiae53423%
S. pombe55427%
D. melanogaster(not specified)(conserved)
C. elegans(not specified)(conserved)

All of these homologs share similar hydrophobicity profiles, suggesting conservation of structural elements essential for function .

The wide conservation of PIG-S across diverse eukaryotic species indicates that the GPI anchor attachment mechanism emerged early in eukaryotic evolution and has been maintained as an essential cell surface protein modification system. This conservation underscores the critical importance of GPI anchoring for eukaryotic cell surface organization and function.

What is the molecular mechanism by which PIG-S contributes to carbonyl intermediate formation during GPI transamidation?

PIG-S plays a crucial role in the formation of carbonyl intermediates during GPI transamidation, though the precise molecular mechanism remains incompletely characterized. Studies indicate that PIG-S, along with PIG-T, is essential specifically for this step in the transamidation process. During transamidation, the GPI transamidase complex forms a carbonyl intermediate with the substrate protein by cleaving the amide bond between the ω and ω+1 residues of the GPI attachment signal .

The luminally oriented hydrophilic region of PIG-S likely participates in protein-protein interactions within the transamidase complex that are necessary for recognition of the substrate protein or proper positioning of catalytic residues. While GPI8 is thought to provide the catalytic center for the transamidase reaction (based on its homology to cysteine proteases), PIG-S appears to play a structural or regulatory role that is nevertheless essential for activity .

Experiments with alkylating reagents have shown that certain cysteine residues are important for transamidase activity, suggesting that PIG-S may contribute to maintaining the proper redox environment or structural integrity necessary for carbonyl intermediate formation .

How do the biochemical properties of recombinant mouse PIG-S differ from those of other species homologs?

While the search results don't provide comprehensive comparative biochemical data on mouse PIG-S versus other species, we can infer several key points about potential differences based on the sequence conservation data and functional studies:

Mouse PIG-S likely shares high sequence identity with human PIG-S (typically >90% for most conserved proteins between these species), but may have subtle species-specific differences in post-translational modifications, protein-protein interactions, or regulatory mechanisms. The moderate sequence identity (23-27%) between human and yeast homologs suggests functional conservation of core domains but potentially significant differences in regulatory regions or interaction interfaces.

These biochemical differences could manifest in:

  • Subtle differences in transamidase complex assembly kinetics

  • Varying affinities for specific GPI-anchored protein substrates

  • Different sensitivities to inhibitors or stress conditions

  • Species-specific post-translational modifications that affect activity or localization

A thorough biochemical comparison would require expression and purification of recombinant PIG-S from multiple species followed by detailed characterization of their enzymatic properties, structural features, and interaction profiles.

What are the implications of PIG-S dysfunction for embryonic development and disease models?

  • Given that PIG-S knockout in F9 embryonal carcinoma cells leads to complete loss of GPI-anchored protein expression, systemic PIG-S deficiency would likely be embryonically lethal, as many GPI-anchored proteins play critical roles in development.

  • Tissue-specific or partial deficiencies might lead to developmental abnormalities or post-natal diseases affecting:

    • Neural development and function (many neural cell adhesion molecules are GPI-anchored)

    • Immune system function (GPI-anchored proteins like Thy-1 are important in T-cell development)

    • Epithelial barrier function and tissue organization

  • Human diseases associated with defects in GPI anchor biosynthesis pathway genes (collectively known as inherited GPI deficiencies) typically present with:

    • Intellectual disability

    • Seizures

    • Abnormal facial features

    • Various congenital anomalies

Further research using conditional knockout models would be valuable for understanding the tissue-specific roles of PIG-S during development and in disease contexts.

What are the optimal methods for expressing and purifying recombinant mouse PIG-S protein?

Based on the search results and established protein purification principles, the following approach could be used for expressing and purifying recombinant mouse PIG-S:

Expression System Selection:
Given that PIG-S is a membrane protein with two transmembrane domains, mammalian expression systems are likely optimal. For example, the search results mention using human K562 cells for expression of GPI transamidase components . Alternative systems could include:

  • HEK293 cells for high-yield mammalian expression

  • Insect cell systems (Sf9, Hi5) which often provide good yields for membrane proteins

  • Expi293f cells, which were used successfully for expressing recombinant antibodies in the second article

Fusion Tags and Constructs:

  • N-terminal GST tag (as used for GPI8 in the search results)

  • Alternative approaches could include His6 tags, FLAG tags, or other affinity tags

  • Consider removing transmembrane domains for improved solubility if only studying the luminal domain

Purification Strategy:

  • Solubilization with appropriate detergents (NP-40 appears to preserve complex integrity)

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography to separate monomeric from aggregated protein

  • Optional ion exchange chromatography for further purification

Quality Control:

  • SDS-PAGE to confirm purity and expected molecular weight

  • Western blotting to confirm identity

  • Mass spectrometry for precise molecular characterization

  • Functional assays to confirm biological activity

How can researchers effectively analyze the interaction between PIG-S and other components of the GPI transamidase complex?

Several complementary approaches can be used to analyze the interactions between PIG-S and other components of the GPI transamidase complex:

Co-immunoprecipitation (Co-IP):
The search results describe using GST-tagged human GPI8 to isolate the complex through two-step affinity purification . Similar approaches could be applied using tagged PIG-S to pull down interaction partners.

Förster Resonance Energy Transfer (FRET):
By tagging PIG-S and potential interaction partners with appropriate fluorophores, researchers can detect direct protein-protein interactions in living cells.

Bimolecular Fluorescence Complementation (BiFC):
This technique involves splitting a fluorescent protein and fusing each half to potential interacting proteins. If the proteins interact, the fluorescent protein is reconstituted.

Chemical Crosslinking Coupled with Mass Spectrometry:
This approach can identify interaction interfaces by crosslinking closely positioned amino acid residues followed by mass spectrometric analysis.

Yeast Two-Hybrid or Mammalian Two-Hybrid Assays:
These systems can be used to screen for interactions between PIG-S domains and other proteins, though membrane proteins often present challenges in these systems.

Cryo-Electron Microscopy:
For structural analysis of the entire complex, cryo-EM could provide insights into the spatial arrangement of components within the GPI transamidase complex.

The choice of method depends on the specific research question, with Co-IP being most appropriate for confirming interactions, while structural techniques provide more detailed information about the nature of these interactions.

What gene editing approaches are most effective for studying PIG-S function in different model systems?

Based on the search results and current gene editing technologies, the following approaches are effective for studying PIG-S function:

Homologous Recombination:
The research described in the search results successfully used homologous recombination to disrupt the PIG-S gene in mouse F9 cells by replacing the region containing the initiation codon with a drug resistance gene . This approach remains valid, particularly for creating stable knockout cell lines.

CRISPR-Cas9 System:
While not mentioned in the search results (likely due to the age of the studies), CRISPR-Cas9 now represents the gold standard for gene editing and offers several advantages:

  • Higher efficiency than traditional homologous recombination

  • Ability to create precise edits, including point mutations

  • Potential for multiplexing to target multiple genes simultaneously

  • Applicability across diverse model systems including:

    • Mammalian cell lines

    • Mouse models (both germline and somatic editing)

    • Yeast models

    • Invertebrate models (C. elegans, Drosophila)

Conditional Systems:
For studying essential genes like PIG-S where complete knockout may be lethal:

  • Flox/Cre systems for tissue-specific or inducible deletion

  • Degron-based approaches for rapid protein depletion

  • shRNA or siRNA for transient knockdown studies

Rescue Experiments:
As demonstrated in the search results, complementation with wild-type or mutant PIG-S cDNA provides valuable confirmation of phenotype specificity and can be used to study structure-function relationships .

The optimal approach depends on the specific research question, the model system being used, and whether transient or stable modification is required.

How does the functional significance of PIG-S compare to other GPI transamidase components like PIG-T, GAA1, and GPI8?

All components of the GPI transamidase complex are essential for GPI anchor attachment to proteins, but they appear to have distinct functional roles:

ComponentKnown/Proposed FunctionStructural FeaturesKnockout Phenotype
PIG-SEssential for carbonyl intermediate formationTwo transmembrane domains with large luminal domainAccumulated GPI precursors, no GPI-anchored proteins
PIG-TCritical for maintaining complex integrityType-I transmembrane protein with large luminal domainAccumulated GPI precursors, no GPI-anchored proteins
GAA1Function unclear, potentially involved in GPI recognitionMultiple transmembrane domainsAccumulated GPI precursors, no GPI-anchored proteins
GPI8Catalytic subunit (homology to cysteine proteases)Type-I membrane proteinAccumulated GPI precursors, no GPI-anchored proteins

While all components show similar knockout phenotypes (accumulation of GPI precursors and absence of GPI-anchored proteins), their biochemical roles appear complementary:

  • GPI8 likely provides the catalytic center

  • PIG-S and PIG-T are essential specifically for carbonyl intermediate formation

  • PIG-T has a special role in maintaining complex stability

  • GAA1's precise function remains less clear

The essential nature of all components suggests they work together as an integrated functional unit, with no component being functionally redundant.

What are the key differences in experimental approaches when working with recombinant mouse PIG-S versus recombinant chimeric antibodies targeting dendritic cells?

The search results provide information on both PIG-S research and recombinant chimeric antibodies, allowing for comparison of experimental approaches:

AspectRecombinant Mouse PIG-SRecombinant Chimeric Antibodies
Expression SystemsMammalian cell lines (e.g., F9, K562)Expi293f mammalian cells (transient transfection)
Purification MethodsAffinity purification using tags (GST)Affinity chromatography (Protein A)
Functional AssaysGPI-anchored protein expression analysis, GPI synthesis analysis by TLCImmunogenicity assessment, protective immunity evaluation
Model SystemsCell lines, yeast modelsPorcine vaccination models
Structural AnalysisSDS-PAGE, N-terminal sequencingNot specified in search results
Targeting StrategyN/AAntigen targeting to DEC205+ dendritic cells
Outcome MeasuresBiochemical function (GPI attachment)Immune response (antibody production, T-cell activation)

The key differences reflect their distinct biological roles:

  • PIG-S research focuses on intracellular biochemical processes and protein complex formation

  • Chimeric antibody research focuses on immunological outcomes and vaccine development

  • Expression and purification approaches share common principles but with application-specific optimizations

These differences highlight how experimental approaches must be tailored to the specific biological questions being addressed.

How does the structure and function of mouse PIG-S compare to its yeast homologs (S. cerevisiae and S. pombe)?

From the search results, we can draw several comparisons between mouse/human PIG-S and its yeast homologs:

Structural Comparisons:

  • Human PIG-S consists of 555 amino acids

  • S. cerevisiae PIG-S (Gpi17p) consists of 534 amino acids with 23% amino acid identity to human PIG-S

  • S. pombe PIG-S consists of 554 amino acids with 27% identity to human PIG-S and 19% to S. cerevisiae PIG-S

  • All three proteins share similar hydrophobicity profiles, suggesting conservation of structural elements including the transmembrane domains

Functional Comparisons:

  • Both mammalian PIG-S and yeast homologs are essential for GPI anchor attachment

  • Deletion of the yeast homolog (gpi17) results in accumulation of complete GPI precursors (CP), similar to the phenotype seen in PIG-S knockout mammalian cells

  • One notable difference is that gpi17 deletant yeast continued to grow slowly for an extended period (>33 hours), suggesting either a less absolute requirement or longer protein half-life in yeast compared to mammalian cells

Experimental Approaches:

  • Yeast studies often employ different techniques, taking advantage of yeast genetics

  • Metabolic labeling with [³H]inositol (rather than [³H]mannose used in mammalian studies) is commonly used for analyzing mannolipids by TLC in yeast

  • Growth phenotyping is more commonly used as a readout in yeast studies than in mammalian cell studies

These similarities and differences highlight evolutionary conservation of core function while suggesting potential species-specific adaptations in regulation or complex assembly.

What are the most common technical challenges when working with recombinant mouse PIG-S, and how can they be addressed?

Although the search results don't explicitly discuss technical challenges with recombinant mouse PIG-S, we can infer likely challenges based on its properties as a membrane protein and general principles of recombinant protein work:

Challenge 1: Low Expression Levels

  • Problem: Membrane proteins often express poorly in heterologous systems

  • Solution: Optimize codon usage for the expression host, use strong promoters, consider fusion partners that enhance expression, test multiple cell lines, and optimize induction conditions

Challenge 2: Protein Misfolding and Aggregation

  • Problem: Transmembrane domains can cause aggregation when overexpressed

  • Solution: Lower expression temperature, co-express chaperones, use mild detergents for extraction, consider expressing soluble domains separately if appropriate for the research question

Challenge 3: Maintaining Complex Integrity

  • Problem: PIG-S functions as part of a multi-protein complex

  • Solution: Co-express other complex components, optimize detergent conditions to maintain native interactions, consider purifying the entire complex rather than individual components

Challenge 4: Functional Assay Development

  • Problem: Assessing activity of isolated PIG-S may be difficult outside its native complex

  • Solution: Develop cell-based assays using knockout cells complemented with mutant versions, or reconstitute the minimal functional complex in vitro

Challenge 5: Antibody Availability

  • Problem: Specific antibodies for mouse PIG-S may be limited

  • Solution: Generate epitope-tagged versions, develop custom antibodies, or use mass spectrometry-based approaches for detection and quantification

How can researchers troubleshoot issues with PIG-S expression in knockout rescue experiments?

Based on the rescue experiments described in the search results and general principles of molecular biology, here are approaches to troubleshoot PIG-S expression issues in knockout rescue experiments:

Issue 1: No Rescue of GPI-Anchored Protein Expression

  • Verification Steps:

    • Confirm transfection efficiency using co-expressed reporters (e.g., GFP)

    • Verify PIG-S mRNA expression by RT-PCR

    • Check protein expression by Western blot (using tags if native antibodies unavailable)

    • Sequence the expression construct to ensure no mutations are present

  • Solutions:

    • Try different expression vectors with stronger promoters

    • Optimize transfection conditions or try different methods (electroporation, viral transduction)

    • Consider stable integration rather than transient expression

    • Test codon-optimized versions of the PIG-S cDNA

Issue 2: Partial Rescue

  • Approach:

    • Quantify the level of GPI-anchored protein expression by flow cytometry

    • Compare expression levels to wild-type cells

    • Assess PIG-S expression levels relative to endogenous expression in wild-type cells

  • Solutions:

    • Increase expression levels if PIG-S is underexpressed

    • Consider whether other transamidase components might be limiting

    • Extend the time after transfection to allow for complete complex assembly

Issue 3: Abnormal Localization of Expressed PIG-S

  • Diagnostic Steps:

    • Use fluorescent tags or immunofluorescence to determine subcellular localization

    • Compare to endogenous PIG-S localization in wild-type cells

  • Solutions:

    • Check for presence of proper targeting signals in the construct

    • Consider the effect of tags on protein trafficking

    • Co-express other complex components that might facilitate proper localization

What are the critical quality control steps for validating recombinant mouse PIG-S in functional studies?

To ensure the validity of functional studies using recombinant mouse PIG-S, researchers should implement the following quality control steps:

Expression Verification

  • Western blot analysis to confirm expression at the expected molecular weight

  • Mass spectrometry to verify protein identity and post-translational modifications

  • Quantitative analysis to determine expression levels relative to endogenous protein

Localization Confirmation

  • Immunofluorescence or subcellular fractionation to verify correct localization to the ER membrane

  • Co-localization with other GPI transamidase components (GAA1, GPI8, PIG-T)

Functional Validation

  • Rescue of GPI-anchored protein expression in PIG-S knockout cells

  • Flow cytometry to quantify surface expression of model GPI-anchored proteins (e.g., Thy-1)

  • Metabolic labeling and TLC analysis to confirm reduction in accumulated GPI precursors

Complex Formation Assessment

  • Co-immunoprecipitation to verify interaction with other transamidase components

  • Size exclusion chromatography to confirm incorporation into the full complex

  • Blue native PAGE to analyze complex integrity

Mutational Analysis

  • Structure-function studies by introducing targeted mutations

  • Complementation assays with mutants to identify critical residues

  • Comparison of activity between wild-type and mutant proteins

Species Specificity Checks

  • Cross-species complementation to assess functional conservation

  • Comparison of activity between mouse PIG-S and homologs from other species

Implementing these quality control measures ensures that any observed phenotypes can be confidently attributed to the specific functions of PIG-S rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.