Recombinant Mouse GRAM domain-containing protein 1A (Gramd1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag is required, please inform us for preferential development.
Synonyms
Gramd1a; D7Bwg0611e; Kiaa1533; Protein Aster-A; GRAM domain-containing protein 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-722
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gramd1a
Target Protein Sequence
MFDTTPHSGRSSPSSSPSLRKRLQLLPPIRPPPASEPEPGTMVEKGSDSSSEKSGVSGTL STQSLGSRNFIRNSKKMQSWYSMLCPTYKQRNEDFRKLFSKLPEAERLIVDYSCALQREI LLQGRLYLSENWICFYSNIFRWETTISIQLKEVTCLKKEKTAKLIPNAIQICTESEKHFF TSFGARDRCFLLIFRLWQNALLEKTLSPRELWHLVHQCYGSELGLTSEDEDYVCPLQLNG LGSPKEVGDVIALSDISPSGAADHSQEPSPVGSRRGRVTPNLSRASSDADHGAEEDKEEQ TDGLDASSSQTVTPVAEPLSSEPTPPDGPTSSLGPLDLLSREELLTDTSNSSSSTGEEGD LAALLPDLSGRLLINSVFHMGAERLQQMLFSDSPFLQGFLQQRKFTDVTLSPWSSDSKCH QRRVLTYTIPISNQLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAHR YCILGLARNKARLRVSSEIRYRKQPWSLVKSLIEKNSWSGIEDYFHHLDRELAKAEKLSL EEGGKDTRGLLSGLRRRKRPLSWRGHRDGPQHPDPDPCTQTSMHTSGSLSSRFSEPSVDQ GPGAGIPSALVLISIVLIVLIALNALLFYRLWSLERTAHTFESWHSLALAKGKFPQTATE WAEILALQKHFHSVEVHKWRQILRASVELLDEMKFSLEKLHQGITVPDPPLDTQPQPDDS FP
Uniprot No.

Target Background

Function

GRAM domain-containing protein 1A (Gramd1a) is a cholesterol transporter that facilitates non-vesicular cholesterol movement from the plasma membrane (PM) to the endoplasmic reticulum (ER). Its unique cholesterol and PM-binding domains act as a molecular bridge for this transfer, playing a critical role in cholesterol homeostasis. Gramd1a's PM localization is dynamically regulated by membrane cholesterol levels; it resides in the ER membrane under lipid-poor conditions and translocates to endoplasmic reticulum-plasma membrane contact sites (EPCS) in response to PM cholesterol excess, a process mediated by its GRAM domain. At the EPCS, the sterol-binding VASt/ASTER domain binds PM cholesterol, enabling its transfer to the ER. Gramd1a may contribute to tumor progression and is implicated in autophagy regulation, being essential for autophagosome biogenesis, a function dependent on its cholesterol-transfer activity.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Single-pass membrane protein. Cytoplasmic vesicle, autophagosome.
Tissue Specificity
Highly expressed in the brain.

Q&A

What is the basic structure and function of GRAMD1A?

GRAMD1A is a protein that contains three main structural components: a transmembrane region, a GRAM domain, and a VASt domain. The protein localizes primarily to the endoplasmic reticulum (ER) with its GRAM domain tethering it to the plasma membrane (PM) where it can bind phosphatidylinositol phosphate in enriched areas . The VASt domain is specifically responsible for binding cholesterol, while the GRAM domain determines the protein's location through sensing cholesterol and binding partially negatively charged lipids in the plasma membrane, particularly phosphatidylserine .

Functionally, GRAMD1A plays crucial roles in:

  • Cholesterol transport from the plasma membrane to the endoplasmic reticulum

  • Autophagosome biogenesis

  • Potential oncogenic activities in certain cancers, such as hepatocellular carcinoma

The protein is expressed ubiquitously throughout the body, with notably higher expression levels in the central nervous system .

How does GRAMD1A differ from other GRAM domain-containing proteins?

GRAMD1A belongs to a family of proteins that includes four paralogs: GRAMD1B, GRAMD1C, GRAMD2A, and GRAMD2B. While GRAMD1A, GRAMD1B, and GRAMD1C all contain VASt domains that can bind cholesterol, GRAMD2A and GRAMD2B lack these domains . These proteins are mammalian representatives of the yeast lipid transfer proteins anchored at membrane contact sites (LAM) family .

Despite their structural similarities, GRAMD1A and GRAMD2A localize to distinct ER-PM contact sites and do not co-localize, with only approximately 8% overlap in their fluorescence patterns when co-expressed . This distinct localization pattern suggests specialized functions, which is further supported by gene set enrichment analysis showing that GRAMD1A and GRAMD2A transcripts correlate with different pathways . Specifically, GRAMD2A/Gramd2a shows positive correlations with genes involved in lipid metabolism, while GRAMD1A/Gramd1a exhibits opposite correlation patterns .

What is the role of GRAMD1A in cholesterol homeostasis?

GRAMD1A plays a critical role in maintaining cholesterol homeostasis by facilitating the transport of cholesterol from the plasma membrane to the endoplasmic reticulum. When plasma membrane cholesterol levels are high, GRAMD1A relocates to contact sites between the plasma membrane and endoplasmic reticulum . At these sites, the VASt domain of GRAMD1A binds cholesterol molecules, enabling their transfer from the plasma membrane to the ER .

This cholesterol transfer activity is essential for proper cellular function and may impact various cellular processes, including autophagy. Research suggests that cholesterol plays a role in regulating early events in autophagosome initiation and phagophore expansion . The membrane cholesterol content increases as autophagosomes mature, partly due to fusion events with cholesterol-rich lysosomes and late endosomes .

How does GRAMD1A contribute to hepatocellular carcinoma progression?

Studies have identified GRAMD1A as a potential prognostic factor for hepatocellular carcinoma (HCC). GRAMD1A is upregulated in HCC tissues, and patients with high GRAMD1A levels demonstrate poorer outcomes . Statistical analyses reveal that GRAMD1A expression positively correlates with pathologic differentiation and survival/mortality rates, establishing it as an unfavorable prognostic factor for HCC patients .

Functional analyses have uncovered multiple oncogenic roles of GRAMD1A in HCC:

  • Cancer stem cell self-renewal: GRAMD1A contributes to the self-renewal capacity of HCC stem cells, as determined through hepatosphere formation assays .

  • Chemotherapy resistance: Higher GRAMD1A expression correlates with increased resistance to chemotherapeutic agents, demonstrated through side population analysis and TUNEL assays .

  • Tumor growth promotion: GRAMD1A enhances tumor growth both in vitro (soft agar growth ability assay) and in vivo (tumor growth models) .

Mechanistically, GRAMD1A exerts these effects by regulating Signal Transducer and Activator of Transcription 5 (STAT5). GRAMD1A influences STAT5 target genes and transcriptional activity, and inhibition of STAT5 in HCC cells overexpressing GRAMD1A suppresses the oncogenic effects of GRAMD1A . This suggests that GRAMD1A promotes HCC development primarily through the STAT5 pathway.

What is the relationship between GRAMD1A and autophagy regulation?

GRAMD1A has been identified as a necessary component for autophagosome biogenesis . Upon autophagy induction, GRAMD1A accumulates at autophagosome initiation sites in the ER, potentially due to the enrichment of PI3P (phosphatidylinositol 3-phosphate) in these regions . GRAMD1A appears to directly participate in initiating autophagosome biogenesis through its regulation of cholesterol homeostasis at phagophores and autophagosomes .

Research using chemical inhibitors (autogramins) has connected GRAMD1A's cholesterol transfer ability to autophagy. Autogramin-2 can displace tracers bound to the GRAMD1A StART domain, while autogramin-1 demonstrates interaction with GRAMD1A in cell lysates . These autogramins serve as GRAMD1A inhibitors and have provided new insights into the physiological consequences of GRAMD1A's cholesterol transfer ability .

The data suggest a model where GRAMD1A's activity is required for autophagosome biogenesis, linking cholesterol homeostasis and autophagy - two critical cellular processes whose connection was previously not well understood.

How do the molecular interactions at ER-PM contact sites influence GRAMD1A function?

GRAMD1A localizes to specialized membrane contact sites (MCS) between the endoplasmic reticulum and plasma membrane. The GRAM domain is critical for this localization, as variants lacking the GRAM domain (GRAMD1aΔGRAM) exhibit diffuse ER localization without focal structures at ER-PM contacts . This indicates that the GRAM domain serves as the primary targeting mechanism to the plasma membrane.

At these contact sites, GRAMD1A's GRAM domain binds specifically to several phosphatidylinositol phosphates:

  • PI3P (phosphatidylinositol 3-phosphate)

  • PI4P (phosphatidylinositol 4-phosphate)

  • PI5P (phosphatidylinositol 5-phosphate)

This binding specificity likely explains GRAMD1A's distinct localization pattern compared to other ER-PM tethers like GRAMD2A and E-Syts2/3. Notably, GRAMD1A and GRAMD2A mark separate ER-PM contact sites with minimal overlap, suggesting functionally specialized domains within the ER-PM interface .

Gene set enrichment analysis further supports this functional specialization, showing that GRAMD1A and GRAMD2A associate with different cellular pathways. While GRAMD2A shows strong positive correlations with calcium signaling pathways, GRAMD1A does not consistently correlate with calcium signaling .

What techniques are used to study GRAMD1A localization and function?

Researchers employ various methodological approaches to investigate GRAMD1A localization and function:

TechniqueApplication in GRAMD1A ResearchKey Findings
Spinning Disk MicroscopyVisualizing localization of fluorescently labeled GRAMD1AGRAMD1A localizes to focal structures at ER-PM contact sites
Total Internal Reflection (TIRF) MicroscopySelective illumination within ~100 nm of the PMGRAMD1A-labeled focal structures co-localize with cortical ER coincident with the PM
Z-stack Imaging3D reconstruction of protein localizationConfirming co-localization of GRAMD1A with both ER and PM markers
Fluorescence PolarizationMeasuring binding affinitiesBodipy-labeled autogramin analogue bound to GRAMD1A StART domain with Kd of 49 ± 12 nM
Differential Scanning Fluorimetry (DSF)Testing protein stabilization by ligandsConfirmed autogramin-2 stabilizes GRAMD1A
Cellular Thermal Shift AssayAssessing protein-ligand interactions in cell lysatesDemonstrated autogramin-1 interaction increases GRAMD1A melting temperature by 2.1°C

For functional studies, researchers utilize:

  • Hepatosphere formation assays: To assess cancer stem cell self-renewal capacities influenced by GRAMD1A

  • Side population analysis: To evaluate chemotherapy resistance in cells with differential GRAMD1A expression

  • TUNEL assays: To measure apoptosis levels in response to GRAMD1A modulation

  • Soft agar growth ability assay and in vivo tumor growth models: To study the impact of GRAMD1A on tumor growth

  • Gene set enrichment analysis (GSEA): To identify pathways correlated with GRAMD1A expression

How can researchers effectively modulate GRAMD1A activity in experimental systems?

Several approaches have been developed to modulate GRAMD1A activity in experimental settings:

  • Genetic manipulation:

    • Overexpression of full-length GRAMD1A to study gain-of-function effects

    • Domain deletion constructs (e.g., GRAMD1aΔGRAM) to study domain-specific functions

    • siRNA or CRISPR-based knockdown/knockout to study loss-of-function effects

  • Chemical inhibition:

    • Autogramin compounds have been identified as specific GRAMD1A inhibitors

    • Autogramin-2 displaces tracers bound to GRAMD1A StART domain

    • These compounds provide valuable tools for studying GRAMD1A function in cellular contexts

  • Reporter systems:

    • NanoLuc-tagged GRAMD1A StART domain can be used in BRET (Bioluminescence Resonance Energy Transfer) assays to study interactions

    • Fluorescently labeled constructs (e.g., GRAMD1a-eGFP) for localization studies

When designing experiments to modulate GRAMD1A, researchers should consider:

  • The specific domain being targeted (GRAM vs. VASt)

  • The cellular context (cancer vs. normal cells)

  • Potential compensatory mechanisms from paralog proteins (GRAMD1B, GRAMD1C)

  • The specific cellular process being studied (cholesterol transport, autophagy, or cancer-related functions)

What are the current challenges and limitations in recombinant GRAMD1A production and purification?

While the search results don't explicitly detail challenges in recombinant GRAMD1A production, several considerations can be inferred based on the protein's structure and function:

  • Membrane protein challenges:

    • As a transmembrane protein that localizes to the ER, GRAMD1A likely presents typical challenges associated with membrane protein expression and purification

    • Maintaining proper folding and functionality outside its native membrane environment requires careful optimization of detergents or lipid environments

  • Domain preservation:

    • Ensuring that both the GRAM and VASt domains retain their binding capabilities after purification is crucial

    • The StART domain of GRAMD1A has been successfully expressed recombinantly for binding studies , suggesting domain-specific expression strategies may be effective

  • Functional validation:

    • Validating the cholesterol-binding activity of purified GRAMD1A requires specialized assays

    • Fluorescence polarization experiments with labeled lipids or autogramin analogs can assess binding capabilities

  • Species differences:

    • While the query specifies mouse GRAMD1A (Gramd1a), most research appears to focus on human GRAMD1A

    • Researchers should consider potential functional differences between species when designing experiments

What are the potential therapeutic applications of targeting GRAMD1A?

Based on current research, several therapeutic applications of targeting GRAMD1A show promise:

  • Cancer treatment:

    • GRAMD1A has been identified as an unfavorable prognostic factor in HCC

    • Inhibiting GRAMD1A could potentially reduce cancer stem cell self-renewal, enhance chemosensitivity, and reduce tumor growth

    • The GRAMD1A-STAT5 axis represents a potential therapeutic target for HCC treatment

  • Autophagy modulation:

    • GRAMD1A is necessary for autophagosome biogenesis

    • Autogramins, as GRAMD1A inhibitors, could serve as tools to modulate autophagy in contexts where autophagy inhibition is therapeutically beneficial

    • Further research is needed to understand the downstream effects of GRAMD1A inhibition on autophagic flux in different disease contexts

  • Cholesterol homeostasis disorders:

    • Given GRAMD1A's role in cholesterol transport , targeting this protein could potentially address disorders related to cholesterol dysregulation

    • The specificity of GRAMD1A for certain membrane domains may allow for targeted interventions in specific cellular compartments

How might GRAMD1A function in neurodegenerative diseases given its elevated expression in the CNS?

While the search results don't directly address GRAMD1A's role in neurodegenerative diseases, its higher expression levels in the central nervous system and its functions in cholesterol homeostasis and autophagy suggest potential implications:

  • Cholesterol homeostasis in neurodegeneration:

    • Cholesterol metabolism is crucial for brain function, and its dysregulation is implicated in several neurodegenerative disorders

    • GRAMD1A's role in transporting cholesterol between membrane compartments may impact neuronal health and function

    • Research could investigate whether GRAMD1A expression or function is altered in models of neurodegenerative diseases

  • Autophagy in neurodegeneration:

    • Defective autophagy is a hallmark of many neurodegenerative diseases

    • GRAMD1A's role in autophagosome biogenesis suggests it might influence the clearance of protein aggregates characteristic of conditions like Alzheimer's and Parkinson's diseases

    • Studies could examine whether modulating GRAMD1A activity affects the progression of neurodegeneration in relevant models

  • ER-PM contact sites in neurons:

    • ER-PM contact sites are critical for calcium signaling and lipid homeostasis in neurons

    • GRAMD1A's localization to these contact sites may influence neuronal signaling and health

    • Research into GRAMD1A's neuronal functions could reveal new insights into neurodegenerative disease mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.