Recombinant Mouse Growth hormone receptor (Ghr)

Shipped with Ice Packs
In Stock

Description

Production and Formulation

  • Expression System: Mammalian cells (e.g., HEK293) ensure proper glycosylation and folding .

  • Formulations:

    • Carrier-Free (CF): Lyophilized from PBS, ideal for assays where bovine serum albumin (BSA) may interfere .

    • BSA-Stabilized: Enhances stability for cell culture or ELISA standards .

  • Reconstitution: 100 μg/mL in PBS; store at -20°C to -80°C to prevent aggregation .

GH-GHR Signaling Mechanisms

GHR activation triggers JAK2/STAT5 pathways, influencing:

  • Growth and Metabolism: Direct regulation of IGF-1 synthesis and glucose homeostasis .

  • Immune Function: Enhances T cell survival and thymic output .

  • Aging: GHR knockout (GHRKO) mice exhibit extended lifespan (up to 5 years) and reduced oxidative damage .

Pathophysiological Insights

  • Laron Syndrome (GHR Deficiency):

    • Mouse Models: GHRKO mice replicate human phenotypes: dwarfism (50% size reduction), elevated GH, and low IGF-1 .

    • Therapeutic Testing: Gene therapy using AAV-GHR partially restores IGF-1 levels and body weight in GHRKO mice .

Experimental Uses

  • Binding Assays: Measure GH-GHR interactions (e.g., ELISA, surface plasmon resonance) .

  • Signaling Studies: Investigate JAK/STAT activation in cell lines .

  • Therapeutic Development: Test GH analogs or gene therapies for growth disorders .

Table 1: Phenotypic Effects of GHR Disruption in Mice

ParameterGHRKO MiceWild-Type Mice
Body Weight50% reduction Normal
Serum IGF-190% reduction 100%
Lifespan (Female)Increased by 20–30% Standard
Insulin SensitivityEnhanced (males) Normal

Table 2: Efficacy of AAV-GHR Gene Therapy in GHRKO Mice

OutcomeAAV-GHR TreatmentUntreated Controls
Serum IGF-1Increased 3-foldUndetectable
Body Weight Gain15–20% improvementNo change
Organ WeightLiver, kidney increasedReduced

Technical Considerations for Use

  • Cross-Reactivity: ~50% with rat GHR in Western blots .

  • Antibody Validation: Anti-GHR antibodies (e.g., AF1360) detect receptor expression in liver, adipose tissue, and muscle .

  • Storage: Avoid repeated freeze-thaw cycles; reconstituted protein stable for 3–6 months at -80°C .

Future Directions

  • Mechanistic Studies: Resolve residual GH binding in GHRKO tissues, suggesting alternative receptors .

  • Clinical Translation: Optimize gene therapy doses to improve growth outcomes in Laron syndrome .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ghr; Growth hormone receptor; GH receptor; Somatotropin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-650
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Ghr
Target Protein Sequence
TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
Uniprot No.

Target Background

Function
The growth hormone receptor (GHR) is a transmembrane protein that serves as the receptor for pituitary gland growth hormone (GH). It plays a crucial role in regulating postnatal body growth. Upon ligand binding, GHR activates the JAK2/STAT5 signaling pathway. The soluble form of GHR, known as GHBP, acts as a reservoir of growth hormone in plasma and may modulate or inhibit GH signaling.
Gene References Into Functions
  1. GHR -/- mice exhibited reduced body weight but increased percentage of fat mass. Serum FGF21 levels remained unchanged in GHR -/- mice. Expression of Fgf21, Fgfr1, and Klb mRNA in white adipose tissue and liver were downregulated or unchanged in GHR -/- mice. The only exception was Fgf21 expression in brown adipose tissue of GHR -/-, which showed a trend towards increased expression. PMID: 27585733
  2. GH plays a role in influencing hormone signaling in adipose tissue in a depot-dependent manner in GHR-/- knockout mice. PMID: 28323915
  3. Disruption of cardiomyocyte GH-induced signaling in adult GhrKO mice does not affect cardiac function, but it contributes to systemic glucose homeostasis, partly through modulation of circulating IGF-1. PMID: 27035649
  4. Snell, GHKRO, and PAPPA-KO mice express high levels of two proteins involved in DNA repair, O-6-methylguanine-DNA methyltransferase (MGMT) and N-myc downstream-regulated gene 1 (NDRG1). PMID: 27618784
  5. Adult-onset growth hormone receptor knockout mice (aGHRKO mice), similar to GHRKO animals, display retarded growth and high adiposity with improved insulin sensitivity. Notably, female aGHRKO animals showed an increase in their maximal lifespan, while the lifespan of male aGHRKO mice was not different from controls. PMID: 27732088
  6. Similar to other mice with decreased GH action, female GHA mice exhibit reduced age-related lipid redistribution and improved insulin sensitivity, but no change in cellular senescence. PMID: 26372907
  7. The dwarf phenotype was partially corrected by administering a plasmid containing the growth hormone gene intramuscularly, depending on the age at treatment. PMID: 26774398
  8. GHR-dependent downregulation of NLRP3 inflammasome in macrophages is linked to pro-longevity effects that maintain immune system homeostasis during aging. PMID: 26876170
  9. Both brown adipose tissue (BAT) and white adipose tissue (WAT) contribute differently to phenotypes in GHRKO mice. Ghr ablation blunts inflammation in BAT as well as cellular metabolism and mitochondrial biogenesis in WAT. PMID: 26436954
  10. Data, including those from knockout mice studies, suggest that Socs2 (suppressor of cytokine signaling 2) regulates liver regeneration rate after partial hepatectomy, Ghr level via ubiquitination/proteolysis, and serum Igf1 (insulin-like growth factor-1). PMID: 26703468
  11. Removing GHR in muscle of male MuGHRKO mice replicates some of the health benefits observed in global GHR-/- mice, including improvements to glucose homeostasis and smaller body weight in males. PMID: 26233957
  12. GHR knockdown led to increased hepatic de novo lipogenesis (DNL), along with increased glucokinase mRNA and protein levels as well as fructose-2,6-bisphosphate levels. PMID: 26015548
  13. Deletion in the liver affects regulators of mitochondrial biogenesis. PMID: 25855408
  14. Global GHR deletion induces beneficial changes in apoptotic factors, whereas liver-specific GHR disruption does not. Sexual dimorphism may play a role in regulating apoptosis during liver-specific suppression of the somatotrophic signaling. PMID: 24550353
  15. Loss of Ghr signaling may slow the progression from fibrosis/cirrhosis to cancer in the liver. PMID: 25179284
  16. Mice with GHR disrupted only in the liver do not exhibit extended lifespan and also fail to show the decline in mTORC1 and increase in mTORC2 seen in mice with global loss of GHR. PMID: 25456069
  17. Hematopoietic-specific genetic deletion of Ghr did not impact steady-state hematopoiesis nor serial transplantation potential. PMID: 25274507
  18. GHRs exist as approximately 500-kDa complexes that dimerize into active approximately 900-kDa complexes upon GH binding. The dimerized complexes serve as platforms for transient interaction with JAK2 and ubiquitin ligases. PMID: 24280222
  19. Data from mutant/knockout mice suggest that Ghr in the liver (not muscle or adipose tissue) is involved in regulating the expression of xenobiotic metabolizing enzymes. PMID: 23941873
  20. Data from knockout/transgenic mice suggest that neither Ghr nor Igf1r (insulin-like growth factor I receptor) signaling is required for postnatal skeletal muscle development or for regeneration in response to cardiotoxin injury. PMID: 23861377
  21. Serum IGF-1 is insufficient to restore skeletal size in the complete absence of the growth hormone receptor. PMID: 23456957
  22. Results suggest that GH sensitivity is rapidly impaired after acute injury and that trauma combined with hemorrhage leads to a more severe form of GH resistance resulting from alteration or inactivation of hepatic GHR. PMID: 23417424
  23. Upregulation of the angiotensin-converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in the heart and kidney of growth hormone receptor knock-out mice. PMID: 22947377
  24. Muscle growth hormone receptor signaling regulates basal lipid oxidation, but not the induction of lipid oxidation in response to fasting. PMID: 23024761
  25. These findings suggest that diabetes induces an imbalance in the GH/IGF-1 system, leading to altered activity in the prefrontal cortex and associated cognitive deficiencies. PMID: 22750159
  26. The insulin-like growth factor I receptor may act as a proximal component of growth hormone/growth hormone receptor signaling, contributing to the enhancement of pancreatic beta-cell mass and function. PMID: 22034225
  27. Skeletal muscle GHR signaling mediates insulin resistance in obesity and, importantly, plays a role in facilitating communication between muscle and other metabolic tissues. PMID: 22187377
  28. Renal levels of PGC-1alpha, AMPKalpha, p-AMPKalpha, SIRT-3, eNOS, p-eNOS, and MFN-2 were increased in growth hormone receptor knockout. PMID: 21755522
  29. Data indicate a significant role for GHR signaling in liver regeneration. GHR acts through activation of both epidermal growth factor receptor and Erk1/2 pathways. Liver regeneration is considerably delayed in mutant GHR knockout mice. PMID: 21540290
  30. Data point to a role for GH in establishing pubertal skeletal and body size that is independent of hepatic IGF-1 production. PMID: 20928887
  31. The GH receptor plays critical roles in glucose-stimulated insulin secretion and beta cell compensation in response to a high-fat diet. PMID: 21555853
  32. The decreased renal levels of pro-apoptotic proteins could contribute to the extended lifespan caused by targeted disruption of the GH receptor gene but are apparently not involved in mediating the effects of visceral fat removal. PMID: 21391871
  33. These findings identify distinct signaling pathways through which the growth hormone receptor regulates skeletal muscle development and modulates nutrient metabolism. PMID: 20921627
  34. Compared to wild-type controls, GHR -/- mice were smaller, consumed more food, and had higher energy expenditure. PMID: 19747867
  35. In studies using targeted knock-in mice with mutation in the Ghr Box1 motif (disabling Jak2 activation by Ghr), data indicate that Ghr activation of Src and Erk1/2 is independent of Jak2. PMID: 19884384
  36. An intermittent fasting diet increased the survivorship and improved insulin sensitivity of normal males but failed to affect either parameter in GHR-KO mice. PMID: 19747233
  37. While growth hormone receptor knockout female mice are fertile, they exhibit quantitative deficits in various aspects of reproductive function. PMID: 12297526
  38. In the kidney, diabetes mellitus is associated with enhanced GHR expression and a lack of alteration in the assembly of the repressosome complex. PMID: 12529387
  39. The degree of blockade of growth hormone receptor signaling can lead to significantly different phenotypes. PMID: 12933651
  40. Data suggest that expression of truncated growth hormone receptors (GHRs) is regulated differently from that of the full-length GHR, thereby modulating growth hormone action in murine adipocytes. PMID: 14615057
  41. The aryl hydrocarbon receptor mediates suppression of Ghr. PMID: 14759523
  42. Located on caveolae and lipid rafts of 3t3 cells. PMID: 15010456
  43. Serum igf-i levels and body weights of mature Ghsr-null mice are modestly reduced compared to wild-type littermates. PMID: 15070777
  44. The average size of islets found in GHR(-/-) mice was only one-third of that in wild-type littermates. Total beta-cell mass was reduced 4.5-fold in GHR(-/-) mice, significantly more than their body size reduction. PMID: 15138153
  45. Two truncated isoforms of GHR mRNAs were detected in liver, skeletal muscle, and subcutaneous fat of mice. The ratio of GHR-truncated to GHR-full length mRNA was tissue specific and not affected by chronic excess or deficiency of GH. PMID: 15165994
  46. Targeted disruption of the GH receptor/GH-binding protein gene and caloric restriction act via overlapping but distinct mechanisms. PMID: 15498882
  47. Specific domains of the GHR regulate body growth and composition. PMID: 15601831
  48. GHR undergoes sequential proteolysis by metalloprotease and gamma-secretases, including PS1. PMID: 15743767
  49. The lower fasting and postmeal plasma ghrelin levels in binge-eating disorder are consistent with lower ghrelin levels in obese compared to lean individuals. PMID: 15867334
  50. Retention of the ubiquitin-dependent endocytosis motif in the N-terminal cytoplasmic domain of the growth hormone receptor permits turnover of these mutant receptors, as no dominant-negative phenotype is observed. PMID: 16166215

Show More

Hide All

Database Links

KEGG: mmu:14600

STRING: 10090.ENSMUSP00000069457

UniGene: Mm.3986

Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Growth hormone-binding protein]: Secreted.
Tissue Specificity
Expressed in all tissues tested including, liver, heart, adipose tissue, mammary gland, testes, ovary, brain, kidney and muscle. Highest levels in liver.

Q&A

What is recombinant mouse Growth Hormone Receptor (GHR) and how is it used in research?

Recombinant mouse GHR is a synthesized protein that mimics the natural growth hormone receptor found in mice. It consists of the extracellular domain of the receptor, often fused with an Fc region to create a chimeric protein. The mouse GHR typically includes sequences from Thr25 to Gln273 (with accession number Q3UP14), which represents the extracellular domain responsible for binding growth hormone . This recombinant protein serves as a vital research tool for studying growth hormone signaling, receptor binding dynamics, and downstream effects of GH-GHR interactions in experimental settings.

Researchers utilize recombinant mouse GHR in numerous applications, including antagonist screening, binding affinity studies, and development of GH-based therapeutics for mouse models. Its carrier-free formulation (without BSA) is particularly valuable for applications where the presence of additional proteins might interfere with experimental outcomes .

What are the main mouse models used to study GHR function and GH signaling?

Several key mouse models have been developed to study GHR function, each offering distinct advantages for addressing specific research questions:

  • GHR−/− mice (Laron mouse model): These mice have a complete disruption of the GHR gene throughout life, resulting in total GH insensitivity. They exhibit postnatal growth retardation, short stature, elevated serum GH, and decreased IGF-1 levels, mirroring human Laron Syndrome .

  • Adult-onset GHR knockout mice (aGHRKO): In these mice, the GHR gene is disrupted at approximately 6 weeks of age, allowing for normal development followed by induced GH insensitivity. This model helps distinguish between developmental and adult effects of GH signaling .

  • GHR antagonist transgenic mice (GHA mice): These mice express a GHR antagonist that competes with endogenous GH for receptor binding, resulting in partial GHI .

  • Tissue-specific GHR knockout mice: Generated via Cre-lox technology, these models allow for the study of GH action in specific tissues while maintaining normal GH signaling elsewhere .

  • GHRH knockout mice (GHRHKO): These mice have targeted ablation of the GHRH gene, resulting in GH deficiency rather than insensitivity, and are used to study GH replacement therapy effects .

Each model presents a different degree of GH insensitivity or deficiency, enabling researchers to explore various aspects of GH/GHR biology and signaling pathways.

What is the appropriate handling and reconstitution protocol for recombinant mouse GHR?

For optimal results when working with recombinant mouse GHR Fc chimera, the following methodology is recommended:

  • Storage: Store lyophilized protein at -20°C to -80°C in a manual defrost freezer, avoiding repeated freeze-thaw cycles to maintain protein integrity .

  • Reconstitution: Reconstitute the lyophilized protein at a concentration of 100 μg/mL in sterile PBS. Allow the protein to sit for at least 15 minutes at room temperature to ensure complete solubilization .

  • Working solutions: Prepare working dilutions in an appropriate buffer containing a carrier protein (such as 0.1% BSA) for applications other than those where BSA would interfere.

  • Stability after reconstitution: Store reconstituted protein in working aliquots at -20°C to -80°C for maximum stability. Avoid repeated freeze-thaw cycles by preparing single-use aliquots .

  • Quality control: Before use in critical experiments, verify protein activity using appropriate functional assays.

The carrier-free formulation is specifically recommended for applications where the presence of BSA might interfere with experimental outcomes, while BSA-containing preparations offer greater stability for general use in cell culture or as ELISA standards .

What phenotypic characteristics define GHR knockout mice compared to wild-type controls?

GHR knockout mice display several distinctive phenotypic characteristics that reflect the absence of GH signaling:

Growth and body composition:

Metabolic parameters:

  • Hepatic steatosis even on normal chow diet

  • Improved insulin sensitivity despite increased adiposity

  • Altered glucose metabolism

  • Changes in various IGF binding proteins (reduced IGFBP-1, IGFBP-3, and IGFBP-4; increased IGFBP-2)

Reproductive and developmental aspects:

  • Delayed puberty in both sexes

  • Reduced fertility in males

  • Preserved but altered fertility in females with decreased preovulatory follicles and corpora lutea

Lifespan effects:

  • Extended longevity, particularly in females

  • Resistance to certain age-related diseases

  • Reduced cancer incidence

These characteristics make GHR knockout mice valuable models for studying the role of GH/IGF-1 signaling in development, metabolism, and aging.

How do different GHR knockout models (germline vs. adult-onset) affect experimental outcomes?

The timing of GHR disruption significantly influences experimental outcomes, with important distinctions between germline (GHR−/−) and adult-onset (aGHRKO) models:

Germline GHR knockout (GHR−/−):

  • Exhibits both developmental and post-developmental effects of GH insensitivity

  • Shows more pronounced growth retardation due to absence of GH signaling during critical growth periods

  • Displays approximately 45-55% reduction in body size compared to wild-type

  • Demonstrates more dramatic alterations in metabolic parameters

  • Shows more complete disruption of GHR across all tissues

Adult-onset GHR knockout (aGHRKO):

  • Allows normal development until 6 weeks of age, isolating adult effects of GH insensitivity

  • Shows tissue-specific variability in GHR disruption (e.g., nearly complete in liver but minimal in heart)

  • Displays tissue-specific reductions in IGF-1 expression (up to 99% in liver, but 29-57% in fat tissues)

  • Replicates many but not all metabolic benefits of germline knockout

  • Shows sex-specific effects on lifespan, with increased maximal lifespan observed only in females

This comparison reveals that while both models demonstrate GH insensitivity, the timing of GHR disruption creates distinct phenotypes. The aGHRKO model more closely resembles potential therapeutic GH/IGF-1 axis suppression in humans, as it avoids developmental complications while still conferring many metabolic benefits .

For researchers, these differences underscore the importance of model selection based on specific research questions. The aGHRKO model may be more appropriate for studying potential adult interventions, while the germline model better represents congenital GH insensitivity syndromes.

What is the optimal dosing schedule for recombinant mouse GH replacement therapy in GH-deficient mice?

The effectiveness of recombinant mouse GH (rmGH) replacement therapy depends significantly on the dosing regimen. Research comparing different administration schedules in GHRH knockout (GHRHKO) mice has revealed important methodological considerations:

Comparative effectiveness of dosing regimens:

ParameterRegimen 1 (R1): Daily DosingRegimen 2 (R2): Twice-Daily DosingWild-Type Controls
Dosing Week 130 μg once daily15 μg twice dailyN/A
Dosing Week 250 μg once daily25 μg twice dailyN/A
Dosing Weeks 3-470 μg once daily35 μg twice dailyN/A
Body weight normalizationCompleteExceeded control valuesReference
Tibia length normalizationCompleteExceeded control valuesReference
Femur length normalizationCompleteExceeded control valuesReference
Body composition correctionCompleteCompleteReference

Key findings demonstrate that while both regimens corrected body composition abnormalities (increased subcutaneous fat and reduced lean mass), the twice-daily administration (R2) produced significantly greater increases in total body weight and femur length compared to wild-type controls .

Interestingly, neither treatment regimen produced corresponding changes in circulating IGF-1 levels or liver IGF-1 mRNA expression, suggesting local IGF-1 production may be more relevant for growth effects than systemic IGF-1 .

For researchers conducting GH replacement studies, these results indicate that:

  • Species-specific GH should be used to avoid antibody development

  • Twice-daily administration is more effective than single daily dosing

  • Growth parameters can be normalized without normalization of circulating IGF-1 levels

This methodological insight is crucial for designing interventional studies in GH-deficient mouse models.

How do sex differences influence outcomes in GHR knockout mouse models?

Sex-specific differences represent a critical variable in GHR knockout research, with substantial implications for experimental design and interpretation:

Growth and body composition:

  • Male GHR−/− mice maintain approximately 56% of wild-type body weight at 104 weeks

  • Female GHR−/− mice demonstrate more pronounced size reduction, reaching only 44% of wild-type weight at the same age

  • Sexual dimorphism in adipose tissue distribution differs between knockout and wild-type animals

Metabolic parameters:

  • Sex-specific differences in insulin sensitivity and glucose metabolism

  • Females generally display more pronounced metabolic improvements than males

Reproductive function:

  • Males show reduced fertility with delayed sexual maturation

  • Females maintain fertility despite decreased preovulatory follicles and corpora lutea

Lifespan effects:

  • In germline knockouts, both sexes show extended longevity

  • In adult-onset GHR knockout (aGHRKO) mice, only females demonstrate increased maximal lifespan

  • Male aGHRKO mice show no significant lifespan difference compared to controls

This sexual dimorphism in response to GHR disruption highlights the complex interaction between growth hormone signaling and sex-specific physiology. For researchers, these findings underscore the importance of:

  • Including both sexes in experimental designs

  • Analyzing and reporting data in a sex-specific manner

  • Considering sex as a biological variable when interpreting results

  • Recognizing potential limitations when translating findings between sexes

The observation that female mice benefit more from adult-onset GHR disruption in terms of longevity suggests sex-specific mechanisms in GH/IGF-1 signaling that warrant further investigation .

What molecular mechanisms distinguish different types of GH insensitivity in mouse models?

GH insensitivity (GHI) in mouse models can result from disruptions at various levels of the GH signaling pathway, each with distinct molecular mechanisms:

Receptor-level insensitivity:

  • Complete GHR deletion (GHR−/−): Results in absence of GHR protein, preventing all GH binding and downstream signaling. This leads to dramatic reduction in IGF-1 production (<20% of wild-type levels) and complete blockade of JAK/STAT signaling pathway activation .

  • Partial GHR disruption (aGHRKO): Creates tissue-specific variability in GHR expression. For example, liver shows near-complete reduction while heart maintains normal expression. This leads to tissue-specific reductions in local IGF-1 production, with liver showing 99% reduction but adipose tissue showing only 29-57% reduction .

  • GHR antagonism (GHA mice): Involves competitive binding of a GHR antagonist that prevents receptor dimerization and subsequent signaling cascade activation, resulting in partial inhibition .

Post-receptor signaling defects:

  • JAK2 deficiency: Disrupts the primary kinase involved in GHR signaling

  • STAT5 mutations: Impairs a critical transcription factor downstream of GHR activation

  • SOCS protein overexpression: Enhances negative feedback inhibition of GH signaling

These different mechanisms produce distinct phenotypes and varying degrees of GHI. For example, complete GHR knockout results in more severe growth retardation than GHR antagonism. Similarly, tissue-specific knockout models demonstrate that hepatic GHR signaling contributes differently to systemic phenotypes than adipose tissue GHR signaling.

For researchers, understanding these nuanced mechanisms helps in:

  • Selecting appropriate models for specific research questions

  • Interpreting experimental results in the context of pathway disruption

  • Developing targeted interventions for specific components of the GH signaling cascade

  • Distinguishing between direct effects of receptor absence versus secondary adaptations

How can researchers distinguish direct GH effects from IGF-1-mediated effects in mouse models?

Distinguishing direct GH actions from those mediated by IGF-1 represents a significant methodological challenge in growth hormone research. Several experimental approaches can help researchers delineate these effects:

1. Comparative model analysis:

  • Using GHR knockout mice in parallel with liver-specific IGF-1 knockout mice

  • Comparing phenotypes of global GHR knockout versus tissue-specific GHR knockout

  • Studying models with intact GHR but impaired IGF-1 production

2. Temporal intervention studies:

  • The adult-onset GHR knockout (aGHRKO) model provides valuable insights, as it showed that GH-induced parameter modifications were not reflected in parallel changes in circulating IGF-1 or liver IGF-1 mRNA levels

  • This dissociation between growth parameters and IGF-1 levels suggests direct GH effects independent of hepatic IGF-1 production

3. Tissue-specific analysis:

  • Local IGF-1 production in target tissues may be more relevant than systemic IGF-1 for certain GH effects

  • In GHRHKO mice treated with rmGH, growth parameters normalized despite no corresponding changes in circulating IGF-1 levels

  • Analysis of tissue-specific GHR knockout models reveals which phenotypic changes require local GH action versus those mediated by hepatic IGF-1

4. Molecular signaling pathway examination:

  • GH activates JAK/STAT, MAPK, and PI3K pathways directly

  • IGF-1 primarily signals through the IGF-1 receptor via PI3K/Akt pathways

  • Analysis of tissue-specific phosphorylation patterns of these pathway components can differentiate direct GH signaling from IGF-1 effects

5. Timing-based differentiation:

  • Some GH effects occur rapidly (minutes to hours) and likely represent direct actions

  • Effects requiring new protein synthesis (hours to days) may involve IGF-1 mediation

  • Temporal profiling of responses can help distinguish direct from indirect mechanisms

This methodological approach is essential for correctly attributing observed phenotypes to either direct GH action or IGF-1 mediation, particularly when investigating complex physiological processes like growth, metabolism, and aging.

What are the key considerations for selecting carrier-free versus BSA-containing recombinant mouse GHR preparations?

The choice between carrier-free (CF) and bovine serum albumin (BSA)-containing recombinant mouse GHR preparations depends on specific experimental requirements:

Carrier-free preparations:

  • Recommended applications: Protein interaction studies, receptor binding assays, crystallography, antibody generation, and any application where BSA might interfere with results

  • Advantages: No potential for BSA cross-reactivity, higher purity for analytical applications, elimination of carrier protein competition in binding studies

  • Limitations: Potentially lower stability during storage, may require more careful handling, typically more dilute concentrations

  • Reconstitution protocol: Reconstitute at 100 μg/mL in sterile PBS, with careful attention to complete solubilization

BSA-containing preparations:

  • Recommended applications: Cell culture applications, ELISA standards, and general research use

  • Advantages: Enhanced protein stability, increased shelf-life, protection from denaturation, ability to store at more dilute concentrations

  • Limitations: Potential cross-reactivity with anti-BSA antibodies, interference in mass spectrometry applications, potential masking of epitopes

  • Storage recommendations: Similar to CF preparations but generally more forgiving of freeze-thaw cycles

For critical applications, researchers should validate the performance of both preparations in preliminary experiments to determine which formulation provides optimal results for their specific experimental system.

What methodological approaches are used to measure GHR signaling efficacy in mouse models?

Evaluating GHR signaling efficacy requires a multi-faceted methodological approach spanning molecular, cellular, and physiological analyses:

Molecular signaling assessment:

  • Phosphorylation analysis: Measurement of phosphorylated JAK2, STAT5, ERK1/2, and Akt levels via Western blotting or phospho-specific ELISAs following GH stimulation

  • Gene expression analysis: Quantification of GH-responsive genes (SOCS2, IGF-1, ALS) using qRT-PCR

  • Promoter activity assays: Using reporter constructs containing GH-responsive elements to measure transcriptional activation

  • Protein-protein interaction studies: Co-immunoprecipitation or proximity ligation assays to assess GHR dimerization and recruitment of signaling molecules

Cellular response evaluation:

  • Proliferation assays: Measuring cell division rates in response to GH stimulation

  • Metabolic flux analysis: Assessing changes in glucose uptake, lipid metabolism, or protein synthesis

  • Cellular IGF-1 production: Quantifying local IGF-1 synthesis in response to GH

Physiological parameters:

  • Growth measurements: Tracking body weight, body length, and bone lengths (tibia, femur) as shown in the GHRHKO studies

  • Body composition analysis: Using DXA or MRI to assess lean mass versus fat mass distribution

  • Metabolic assessment: Glucose tolerance tests, insulin sensitivity tests, and energy expenditure measurements

  • Organ-specific responses: Liver IGF-1 production, kidney function, cardiac output, or immune cell activation depending on research focus

Comparative analysis:

  • Dose-response relationships: Establishing ED50 values for various GH effects

  • Temporal response patterns: Distinguishing acute versus chronic GH actions

  • Sex-specific differences: Comparing male versus female responses as highlighted in the aGHRKO studies

This comprehensive approach enables researchers to distinguish between alterations in receptor expression, signaling pathway efficacy, and downstream physiological consequences.

How do different types of GHR fusion proteins affect experimental outcomes?

Different GHR fusion proteins have distinct properties that significantly impact experimental applications and outcomes:

GHR-Fc chimeras:

  • Structure: Consist of the extracellular domain of GHR (typically Thr25-Gln273) fused to the Fc region of human IgG1 (Pro100-Lys330)

  • Benefits: Extended half-life, ease of purification via protein A/G, enhanced stability, potential for dimerization

  • Applications: Receptor binding studies, antagonist screening, immunoprecipitation experiments

  • Limitations: The Fc region may alter binding kinetics or introduce steric hindrance

  • Experimental considerations: Potential for Fc receptor binding in certain cell types must be controlled for with appropriate Fc-only controls

GHR-fluorescent protein fusions:

  • Structure: Full-length GHR fused to GFP, YFP, or other fluorescent proteins

  • Benefits: Enable real-time visualization of receptor trafficking and localization

  • Applications: Receptor internalization studies, FRET-based interaction analysis, subcellular localization

  • Limitations: Fluorescent tags may interfere with some protein-protein interactions

  • Experimental considerations: Validation against untagged receptor function is essential

GHR-luciferase fusion constructs:

  • Structure: Luciferase reporter fused to GHR or its downstream signaling components

  • Benefits: Highly sensitive detection of conformational changes or protein interactions

  • Applications: High-throughput screening, real-time signaling dynamics

  • Limitations: Larger size may affect protein folding or interaction kinetics

  • Experimental considerations: Signal calibration against established functional assays is necessary

Split-GHR complementation systems:

  • Structure: GHR divided into complementary fragments that restore function upon association

  • Benefits: Allow monitoring of specific protein-protein interactions or conformational changes

  • Applications: Studying receptor dimerization dynamics, adaptor protein recruitment

  • Limitations: Artificial system may not perfectly recapitulate native interactions

  • Experimental considerations: Careful design of split sites is crucial for maintaining functionality

The choice of fusion protein should be guided by the specific research question, with attention to potential artifacts introduced by the fusion partner. Validation against unmodified receptor function is essential for accurate interpretation of results.

How do findings from mouse GHR studies translate to human GH insensitivity syndromes?

Mouse GHR studies provide valuable insights into human GH insensitivity syndromes, though important species-specific differences must be considered:

Translatable aspects:

  • Growth phenotypes: GHR−/− mice accurately model the severe postnatal growth failure observed in human Laron Syndrome patients, with both showing proportional dwarfism

  • Metabolic profiles: Both mouse models and human patients display adiposity despite growth restriction, altered glucose metabolism, and insulin sensitivity

  • IGF-1 deficiency: Dramatically reduced circulating IGF-1 levels (<20% of normal) are characteristic of both mouse models and human GHI

  • Therapeutic responses: The effective twice-daily administration of GH in mouse models reflects optimal treatment regimens for some human GH disorders

Species-specific differences:

  • Lifespan effects: While GHR−/− mice consistently show extended longevity, particularly in females, human data on lifespan in Laron Syndrome remains limited and controversial

  • Cancer resistance: GHR−/− mice demonstrate marked cancer resistance, but human data shows variable patterns

  • Developmental timing: The relative developmental stages and growth periods differ between mice and humans

  • Sex hormone interactions: The sexual dimorphism observed in mouse models may not directly parallel human sex differences

Translational applications:

  • Therapeutic targeting: Mouse models enable testing of various interventions targeting the GH/IGF-1 axis with potential human applications

  • Biomarker development: Identification of sensitive biomarkers of GH action in mice that may translate to human diagnostics

  • Mechanistic insights: Molecular pathways identified in mouse models guide investigation of similar mechanisms in human conditions

  • Adult intervention potential: The aGHRKO model specifically informs potential benefits of suppressing GH action in adult humans, as might be considered for therapeutic purposes

For researchers, recognizing both the valuable parallels and important limitations in cross-species translation is essential for appropriate experimental design and interpretation of results in the context of human disease.

What are the current methodological challenges in studying tissue-specific effects of GHR signaling?

Investigating tissue-specific GHR signaling presents several methodological challenges that researchers must address:

1. Temporal and spatial control of gene deletion:

  • Achieving complete Cre-mediated recombination in target tissues without affecting others remains challenging

  • The aGHRKO model demonstrates this issue, with GHR disruption ranging from nearly complete in liver to minimal in heart tissue

  • Development of more specific promoters and inducible systems is needed for precise targeting

2. Distinguishing primary from secondary effects:

  • When GHR is deleted in one tissue, secondary effects on other tissues via altered circulating factors confound interpretation

  • For example, liver-specific GHR knockout reduces systemic IGF-1, affecting all tissues regardless of their GHR status

  • Parallel studies in multiple tissue-specific models may help distinguish direct from indirect effects

3. Compensatory mechanism activation:

  • Tissues often develop compensatory pathways when GHR signaling is disrupted

  • These adaptations may mask or alter the primary phenotype

  • Time-course studies and acute versus chronic comparisons can help identify these mechanisms

4. Standardization of analytical techniques:

  • Different research groups use varied methods to assess GHR expression and signaling

  • Quantitative measures of receptor disruption efficiency vary between studies

  • Standardized approaches for measuring tissue-specific GHR protein and mRNA levels would improve cross-study comparisons

5. Sex-specific differences:

  • The finding that female aGHRKO mice show longevity benefits while males do not highlights the importance of sex as a biological variable

  • Sex-specific effects may be tissue-dependent and hormone-dependent

  • Study designs must account for these differences rather than focusing on a single sex

6. Integration of multi-tissue effects:

  • GH actions in one tissue often influence other tissues through complex endocrine and paracrine networks

  • Current methodologies struggle to capture these integrated physiological effects

  • Systems biology approaches combining tissue-specific models with computational integration may address this challenge

Addressing these methodological issues will require development of more sophisticated genetic tools, standardized analytical protocols, and integrated physiological assessment approaches.

What recent technological advances have improved the study of GHR function in mouse models?

Recent technological advances have significantly enhanced the precision and scope of GHR functional studies in mice:

1. CRISPR/Cas9 genome editing:

  • Allows for more precise and efficient generation of GHR knockout or knock-in models

  • Enables introduction of specific point mutations that mirror human GHR variants

  • Facilitates rapid creation of complex models with multiple genetic modifications

  • Reduces off-target effects compared to earlier genetic engineering approaches

2. Advanced inducible systems:

  • Improved temporal control using next-generation Tet-On/Off systems

  • Development of tissue-specific and temporally controlled Cre-ERT2 systems

  • Tamoxifen-inducible models like aGHRKO that allow GHR disruption at specific developmental time points

  • Doxycycline-regulated expression systems for controlled GHR or GHR antagonist expression

3. Single-cell transcriptomics:

  • Reveals cell-specific responses to GH within heterogeneous tissues

  • Identifies previously unrecognized GH-responsive cell populations

  • Characterizes transcriptional networks at unprecedented resolution

  • Helps distinguish direct GH effects from secondary responses

4. In vivo imaging technologies:

  • Real-time visualization of GHR trafficking and signaling using fluorescent fusion proteins

  • Multiphoton microscopy for deep tissue imaging of GH action

  • PET and SPECT imaging with radiolabeled GH or antibodies to track receptor distribution

  • Intravital microscopy to observe GH effects in living tissues

5. Metabolomics and proteomics:

  • Comprehensive assessment of metabolic changes in GHR mutant models

  • Identification of novel GH-regulated pathways through unbiased approaches

  • Characterization of post-translational modifications in GH signaling components

  • Integration of multi-omics data to create systems-level understanding of GH action

6. Organoid and ex vivo culture systems:

  • Development of 3D organoid cultures from GHR mutant mice

  • Manipulation of GHR expression in tissue-specific organoids

  • Preservation of tissue architecture and cellular heterogeneity while allowing experimental control

  • Bridge between in vitro simplicity and in vivo complexity

These technological advances collectively enhance the precision, comprehensiveness, and physiological relevance of GHR research in mouse models, offering new opportunities to address previously intractable questions about tissue-specific and temporal aspects of GH action.

What are the emerging directions in GHR research based on recent mouse model findings?

Recent findings from mouse GHR models have opened several promising research directions with significant basic science and translational potential:

Targeting GH/IGF-1 axis for healthy aging:

  • The discovery that adult-onset GHR disruption extends maximal lifespan in female mice suggests potential therapeutic value in modulating GH signaling during adulthood

  • Sex-specific effects highlight the need for personalized approaches to GH/IGF-1 axis intervention

  • Partial rather than complete inhibition may offer benefits while minimizing adverse effects

Tissue-specific GH actions:

  • Growing evidence indicates that GH's effects vary substantially between tissues

  • Research is moving toward understanding tissue-specific contributions to systemic phenotypes

  • Targeting GHR in specific tissues may achieve desired benefits while avoiding unwanted effects in other tissues

Mechanistic understanding of GH/metabolic interactions:

  • The paradoxical combination of increased adiposity with improved insulin sensitivity in GHR−/− mice challenges conventional understanding of metabolism

  • Future research will likely focus on mechanisms underlying this "healthy obesity" phenotype

  • Understanding how GH modulates adipose tissue function and distribution remains a key research priority

Optimizing GH replacement protocols:

  • Finding that twice-daily administration of rmGH is more effective than daily dosing in GH-deficient mice has direct clinical implications

  • Further refinement of dosing schedules, delivery systems, and formulations continues to be an active area of investigation

  • Long-acting GH preparations may offer advantages over current replacement protocols

GH action beyond growth and metabolism:

  • Emerging evidence for GH involvement in cognition, immune function, and stress responses

  • Investigation of GH/GHR in non-traditional target tissues including brain, immune cells, and reproductive organs

  • Potential connections between GH signaling and resistance to age-related diseases beyond metabolism

Integration with other hormonal systems:

  • Growing recognition that GH interacts with numerous other endocrine pathways

  • Research exploring how GH/insulin/thyroid hormone/sex steroid interactions shape physiological outcomes

  • Systems biology approaches to map the complex network of hormone interactions

These emerging directions represent fertile ground for future investigation, with potential to transform our understanding of GH biology and its clinical applications.

How can researchers optimize experimental design when using recombinant mouse GHR and GH in laboratory studies?

Optimizing experimental design for recombinant mouse GHR and GH studies requires careful consideration of multiple methodological factors:

1. Species specificity considerations:

  • Always use species-matched GH for mouse studies, as human GH in mice causes antibody development and progressive reduction in effectiveness

  • Consider species compatibility when using GHR-Fc chimeras in binding or neutralization studies

  • Validate antibody specificity for mouse versus human GHR when conducting immunological detection

2. Dosing optimization:

  • Implement escalating dose regimens when initiating GH treatment in deficient models

  • Consider twice-daily administration rather than single daily dosing for maximal efficacy

  • Establish complete dose-response relationships rather than single-dose experiments

  • Typical effective doses range from 15-70 μg/day depending on age and administration frequency

3. Formulation selection:

  • Choose carrier-free preparations for binding studies, crystallography, or when BSA might interfere

  • Select BSA-containing preparations for cell culture or general applications requiring enhanced stability

  • For reconstitution, use sterile PBS at recommended concentrations (typically 100 μg/mL)

4. Control selection:

  • Include both wild-type and heterozygous controls when studying GHR knockouts

  • Consider using inactive GH or Fc-only proteins as controls for GH or GHR-Fc studies

  • Match controls for age, sex, genetic background, and housing conditions

5. Measurement timing:

  • Account for GH's pulsatile secretion pattern when measuring endogenous GH

  • Collect samples at consistent times relative to dosing for pharmacokinetic/pharmacodynamic studies

  • Consider both acute (minutes to hours) and chronic (days to weeks) responses

6. Outcome measures:

  • Include multiple parameters spanning molecular (phosphorylation, gene expression), cellular (proliferation), and physiological (growth, metabolism) responses

  • Measure both direct GH targets and IGF-1-mediated endpoints to distinguish mechanisms

  • For growth studies, assess multiple parameters (body weight, body length, organ weights, tibia/femur length)

7. Sex-specific analysis:

  • Always analyze male and female animals separately

  • Report sex-specific differences in response to interventions

  • Consider hormonal status and estrous cycle when studying female animals

8. Statistical considerations:

  • Conduct power analyses based on expected effect sizes to determine appropriate sample sizes

  • Use mixed-effects models to account for repeated measures

  • Consider variability introduced by genetic background and environmental factors

Following these optimization principles will enhance experimental rigor and reproducibility in GHR research.

What key methodological insights have emerged from comparative studies of different GHR mouse models?

Comparative studies across different GHR mouse models have yielded several critical methodological insights:

1. Timing of GHR disruption determines phenotypic outcomes:

  • Germline versus adult disruption produces distinct phenotypes

  • Adult-onset disruption (aGHRKO) reveals which effects require developmental GH action versus ongoing GH signaling

  • The finding that female aGHRKO mice show extended lifespan while males do not highlights how developmental versus adult GH action may have sex-specific consequences

2. Degree of GHR disruption affects experimental interpretation:

  • Complete knockout (GHR−/−) versus partial antagonism (GHA mice) produces quantitatively different results

  • Tissue-specific disruption efficiency varies even with the same Cre-lox system

  • In aGHRKO mice, liver showed nearly complete GHR reduction while heart maintained normal expression

  • Quantification of disruption efficiency is essential for accurate interpretation

3. Genetic background significantly influences phenotypes:

  • GHR−/− mice on different backgrounds show varying severity of phenotypes

  • Backcrossing to establish congenic lines is necessary for precise comparisons

  • Mixed genetic backgrounds can introduce confounding variables

  • Heterozygous animals may display intermediate phenotypes rather than wild-type characteristics

  • Littermate controls are preferable to non-littermate wild-type animals

  • For tissue-specific models, Cre-only controls are necessary to account for potential Cre toxicity

5. Age-dependent effects require longitudinal studies:

  • Some GH effects manifest differently at various life stages

  • Metabolic consequences of GHR disruption evolve over time

  • Longevity effects require full lifespan studies rather than extrapolation from short-term outcomes

6. Measurement selection influences detectable differences:

  • In GHRHKO mice treated with rmGH, growth parameters normalized without corresponding changes in circulating IGF-1

  • This dissociation demonstrates the importance of measuring multiple endpoints rather than relying on single markers

  • Tissue-specific versus systemic markers may yield contradictory results

7. Environmental factors interact with GHR genotypes:

  • Diet composition markedly affects metabolic phenotypes in GHR mutant mice

  • Temperature, housing conditions, and microbiome influence experimental outcomes

  • Standardization of environmental variables is essential for reproducibility

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.