Recombinant Mouse Heme transporter HRG1 (Slc48a1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
Slc48a1; Hrg1; Heme transporter HRG1; Heme-responsive gene 1 protein homolog; HRG-1; Solute carrier family 48 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc48a1
Target Protein Sequence
MAPSRLQLGLRAAYSGFSSVAGFSIFFVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYM QDYWRTWLRGLRGFFFVGALFSAVSVSAFCTFLALAITQHQSLKDPNSYYLSCVWSFISF KWAFLLSLYAHRYRADFADISILSDF
Uniprot No.

Target Background

Function
Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
Gene References Into Functions
  1. These results identify HRG1 as the long-sought heme transporter for heme-iron recycling in macrophages. This suggests that genetic variations in HRG1 could be modifiers of human iron metabolism. PMID: 23395172
Database Links

KEGG: mmu:67739

UniGene: Mm.28955

Protein Families
HRG family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SLC48A1 (HRG1) in mouse macrophages?

SLC48A1 functions as a heme transporter that plays a crucial role in heme-iron recycling within reticuloendothelial system (RES) macrophages. It specifically transports heme from phagolysosomal compartments to the cytosol where it can be degraded by heme oxygenase-1 (HMOX1) . This process is essential for the recycling of heme-iron from senescent erythrocytes, which occurs primarily in splenic red pulp macrophages (RPMs), liver Kupffer cells, and bone marrow macrophages . The protein enables macrophages to process the enormous volume of heme molecules released during erythrophagocytosis—approximately 100 trillion heme molecules from about five million red blood cells every second .

How can researchers genetically modify mice to study SLC48A1 function?

Researchers can employ CRISPR/Cas9 technology to generate SLC48A1-deficient mouse models. The approach involves designing guide RNAs targeting the SLC48A1 gene and introducing them along with Cas9 into mouse embryos. Successful editing can be confirmed through PCR-based genotyping and subsequent sequencing . When establishing these knockout models, researchers should maintain the mice on an iron-rich diet to support erythropoiesis despite their impaired heme recycling capabilities . It's important to note that unlike HMOX1 knockouts, which exhibit over 90% embryonic lethality, SLC48A1 knockout mice can survive into adulthood with appropriate dietary supplementation .

What analytical methods are effective for measuring heme accumulation in SLC48A1-deficient tissues?

For quantitative assessment of heme accumulation in SLC48A1-deficient tissues, researchers can employ several complementary techniques:

  • Spectrophotometric analysis: Measuring the absorbance spectrum of tissue extracts, with heme showing maximum absorbance at 386 nm, while heme bound to proteins typically shifts to around 408 nm .

  • Histological examination: Observing tissue darkening in the spleen, bone marrow, and liver is an initial indicator of heme accumulation .

  • Hemozoin crystal detection: Using polarized light microscopy to visualize characteristic birefringent crystals in tissue sections .

  • Mass spectrometry: For precise quantification of heme concentrations in different cellular compartments.

  • Electron microscopy: To directly visualize hemozoin crystal formation within the phagolysosomal compartments of macrophages.

These methods should be combined with appropriate controls to accurately assess the over ten-fold excess heme accumulation typically observed in SLC48A1-deficient mice .

How does hemozoin formation occur in SLC48A1-deficient macrophages?

In the absence of SLC48A1, heme accumulates within the erythrophagosome of RES macrophages and is converted into hemozoin biocrystals as a detoxification mechanism . This process occurs within the acidic environment of the phagolysosome. The conversion of heme to hemozoin involves the formation of dimers through iron-carboxylate bonds between the propionate side chain of one heme molecule and the iron center of another, followed by crystal nucleation and growth .

This detoxification strategy was previously known to occur in blood-feeding parasites but has now been demonstrated in mammals lacking SLC48A1 . The acidic pH of the phagolysosome is likely crucial for this process, suggesting a mechanistic link between vacuolar ATPases that maintain lysosomal acidity and hemozoin formation. Researchers investigating this phenomenon should consider:

  • The role of lysosomal pH in promoting hemozoin formation

  • Potential enzymatic or protein scaffolds that might facilitate crystal nucleation

  • The kinetics of hemozoin formation relative to heme accumulation rates

  • Structural similarities between parasite and mammalian hemozoin crystals

What are the key differences between SLC48A1 and HMOX1 knockout phenotypes, and how should these inform experimental design?

The differential phenotypes between SLC48A1 and HMOX1 knockout mice reveal important distinctions in cellular heme handling that researchers should consider when designing experiments:

FeatureSLC48A1 KnockoutHMOX1 Knockout
Embryonic viabilityLargely viable>90% embryonic lethality
Heme accumulation sitePhagolysosomal compartmentCytosolic
Detoxification mechanismHemozoin formationNone (cytotoxicity)
Iron diet requirementsRequires iron-rich dietN/A (largely lethal)
Cellular toxicityLimited due to compartmentalizationSevere cytotoxicity
Effect on macrophage functionImpaired heme-iron recyclingSevere impairment of multiple functions

When designing experiments, researchers should recognize that SLC48A1 deficiency creates a unique model where heme is sequestered as hemozoin within the acidic phagolysosome, resulting in cellular heme tolerance despite high accumulation . In contrast, HMOX1 deficiency leads to cytosolic heme accumulation and subsequent cytotoxicity .

For double knockout studies, the unexpected finding that SLC48A1/HMOX1 double knockouts (DKO) still show embryonic lethality suggests that: (1) HMOX1 has functions beyond heme degradation, or (2) heme degradation products are essential for cell differentiation and development . Experimental designs should account for these possibilities by including appropriate genetic rescue experiments and measuring both heme levels and degradation products in various cellular compartments.

How can researchers effectively validate recombinant SLC48A1 function using complementary model organisms?

Validating recombinant SLC48A1 function requires a multi-model approach similar to methods used for studying HRG-1 orthologues in parasitic nematodes. The following complementary models and validation techniques are recommended:

  • Yeast expression system (S. cerevisiae Δhem1):

    • Transform Δhem1 yeast (deficient in heme biosynthesis) with vectors expressing recombinant SLC48A1

    • Perform haem spot growth assays with 10-fold serially diluted haem-depleted cells on media with various heme concentrations

    • Use 5-aminolevulinic acid (ALA) supplementation as a positive control

    • Conduct gallium protoporphyrin IX (GaPPIX, a toxic heme analogue) assays to confirm transporter functionality

  • C. elegans heterologous expression:

    • Express fluorescently tagged SLC48A1 in C. elegans to visualize subcellular localization

    • Conduct RNAi-mediated knockdown experiments to assess functional conservation

    • Measure zinc mesoporphyrin (ZnMP) uptake to quantify transport activity

    • Assess rescue of heme-deficient phenotypes

  • Mammalian cell culture systems:

    • Express recombinant SLC48A1 in relevant cell lines (e.g., macrophage lines)

    • Perform subcellular localization studies using confocal microscopy

    • Measure heme uptake and trafficking using fluorescent heme analogues

    • Conduct mutagenesis of conserved residues to identify functional domains

A successful validation should demonstrate that recombinant SLC48A1: (1) localizes to the correct subcellular compartments, (2) transports heme or heme analogues, and (3) can functionally complement deficiencies in model organisms .

What experimental approaches should be used to study the structure-function relationships of mouse SLC48A1 compared to its orthologues?

Investigating structure-function relationships of mouse SLC48A1 compared to orthologues requires integrated computational and experimental approaches:

  • Comparative modeling and structural analysis:

    • Use AlphaFold2 or similar tools to predict three-dimensional structures

    • Calculate Root Mean Square Deviation (RMSD) values to quantify structural differences between mouse SLC48A1 and orthologues

    • Identify conserved amino acid residues critical for heme transport

    • Perform in silico docking studies with heme to identify binding sites

  • Spectroscopic characterization:

    • Measure absorption spectra of purified SLC48A1 with and without heme (maximum absorbance for heme alone is typically at 386 nm, while heme bound to proteins shifts to around 408 nm)

    • Use circular dichroism to assess secondary structure changes upon heme binding

  • Mutagenesis studies:

    • Generate mutations in transmembrane domains and conserved residues

    • Test mutant proteins in functional assays to identify essential amino acids

    • Create chimeric proteins between mouse SLC48A1 and parasitic nematode orthologues to identify domains responsible for functional differences

  • Cross-species complementation experiments:

    • Express mouse SLC48A1 in nematode or yeast models

    • Test whether mouse SLC48A1 can rescue phenotypes of HRG-1 deficiency

    • Compare transport kinetics across species

A comprehensive structure-function analysis should explore how the evolutionary distinctiveness of mammalian SLC48A1 (RMSD values ≥1.257 compared to nematode orthologues) affects its functional properties while maintaining conserved heme transport capability .

How does hemozoin formation in SLC48A1-deficient macrophages differ from hemozoin in parasitic organisms?

The unexpected discovery of hemozoin formation in SLC48A1-deficient mammalian macrophages reveals a previously unknown detoxification mechanism that parallels strategies used by blood-feeding parasites. Researchers investigating these differences should consider:

  • Structural comparison:

    • X-ray diffraction analysis of purified hemozoin from SLC48A1-deficient tissues versus parasite hemozoin

    • Electron microscopy to examine crystal morphology, size, and organization

    • Spectroscopic characterization of heme-heme interactions within crystals

  • Formation mechanisms:

    • In parasites, hemozoin formation often involves lipid catalysis or specific proteins

    • In SLC48A1-deficient macrophages, the process may depend on the acidic phagolysosomal environment

    • Investigate potential protein scaffolds or lipid environments that facilitate crystal nucleation

  • Biochemical properties:

    • Solubility under various pH and ionic conditions

    • Stability against degradative enzymes

    • Immunogenicity and inflammatory potential

  • Physiological consequences:

    • Impact on iron recycling and systemic iron homeostasis

    • Effects on macrophage function and inflammatory responses

    • Potential for oxidative damage within macrophages

This comparative analysis would provide insights into the convergent evolution of heme detoxification mechanisms and might reveal novel approaches for managing disorders of iron overload or parasitic infections .

What are the implications of genetic epistasis between SLC48A1 and HMOX1 for experimental heme metabolism studies?

Genetic epistasis studies between SLC48A1 and HMOX1 have yielded unexpected results that challenge our understanding of heme metabolism pathways. While hemozoin sequestration in SLC48A1-deficient mice was predicted to rescue the embryonic lethality observed in HMOX1 knockouts, double knockout (DKO) mice still exhibit significant embryonic lethality with severe impairment in macrophage and erythroblast maturation .

This unexpected finding suggests several important considerations for researchers:

  • Functional HMOX1 requirements:

    • HMOX1 may require SLC48A1 on erythrophagosomal membranes for optimal function

    • In SLC48A1-deficient animals, bioactive HMOX1 levels appear to drop below 50% of expected levels in HMOX1 heterozygous animals

  • Experimental design recommendations:

    • Include conditional knockout models to study tissue-specific effects

    • Develop temporally controlled gene deletion to distinguish developmental from homeostatic roles

    • Measure both HMOX1 protein levels and enzymatic activity in various cellular compartments

    • Assess the subcellular localization of HMOX1 in the presence and absence of SLC48A1

  • Alternative hypotheses to investigate:

    • HMOX1 may have functions beyond heme degradation

    • Heme degradation products (carbon monoxide, biliverdin, iron) may be required for cell differentiation and development

    • The combination of reduced heme degradation products and hemozoin accumulation may synergistically impact cellular functions

GenotypePhenotypeHeme LocationHMOX1 FunctionViability
Wild-typeNormal heme cyclingTransient in cytosolNormalNormal
SLC48A1 KOHemozoin formationPhagolysosomeReduced access to substrateViable with iron supplementation
HMOX1 HETReduced heme degradationCytosol~50% of normalViable
HMOX1 KONo heme degradationCytosol (toxic)Absent>90% embryonic lethal
SLC48A1 KO + HMOX1 HETSevere impairmentMixed<50% of expectedSignificant embryonic lethality

These complex interactions highlight the need for sophisticated genetic models and comprehensive phenotyping approaches when studying heme metabolism pathways .

What are the optimal procedures for expressing and purifying recombinant mouse SLC48A1 for structural studies?

Membrane proteins like SLC48A1 present significant challenges for recombinant expression and purification. Based on successful approaches with related transporters, researchers should consider the following methodological framework:

  • Expression system selection:

    • Insect cell systems (Sf9, High Five) often provide better folding for mammalian membrane proteins

    • Yeast systems (Pichia pastoris) can offer cost-effective high-density culture

    • Mammalian expression systems may be necessary for proper post-translational modifications

  • Construct optimization:

    • Include affinity tags (His6, FLAG) for purification

    • Consider fusion partners to enhance solubility (GFP, MBP)

    • Engineer thermostabilizing mutations based on computational predictions

    • Remove flexible regions that might hinder crystallization

  • Solubilization and purification protocol:

    • Test multiple detergents (DDM, LMNG, GDN) for efficient extraction

    • Implement two-step affinity chromatography followed by size exclusion

    • Consider lipid nanodiscs or amphipols for maintaining native-like environment

    • Assess protein quality through thermal stability assays

  • Functional validation of purified protein:

    • Develop in vitro heme binding and transport assays

    • Verify proper folding through circular dichroism

    • Confirm oligomeric state by analytical ultracentrifugation

  • Structural characterization approaches:

    • X-ray crystallography with lipidic cubic phase crystallization

    • Cryo-electron microscopy for structure determination without crystallization

    • NMR spectroscopy for dynamics studies of specific domains

Each step should be optimized and validated to ensure that the recombinant protein retains its native structure and function, which is critical for meaningful structural studies.

How can researchers effectively design genetic epistasis experiments to study SLC48A1 interactions with other heme metabolism proteins?

Designing genetic epistasis experiments requires careful consideration of genetic backgrounds, conditional systems, and phenotypic readouts:

  • Breeding strategy and genotype verification:

    • Generate single knockout lines before attempting to create double or triple mutants

    • Design genotyping assays that can unambiguously identify all alleles

    • Consider using congenic strains to minimize genetic background effects

    • Calculate expected Mendelian ratios and document embryonic lethality patterns

  • Conditional and inducible systems:

    • Employ tissue-specific Cre-loxP systems to bypass embryonic lethality

    • Use tamoxifen-inducible systems for temporal control of gene deletion

    • Consider hypomorphic alleles to study partial loss-of-function

  • Comprehensive phenotyping approach:

    • Analyze embryonic development at multiple timepoints

    • Assess cell differentiation in bone marrow and spleen

    • Measure heme and iron parameters in multiple tissues

    • Quantify hemozoin formation in relevant cell types

    • Evaluate macrophage function in vitro and in vivo

  • Molecular interactions:

    • Perform co-immunoprecipitation studies to detect protein-protein interactions

    • Use proximity labeling (BioID, APEX) to identify interaction partners

    • Implement fluorescence resonance energy transfer (FRET) to study interactions in living cells

  • Rescue experiments:

    • Test whether wild-type or mutant SLC48A1 can rescue double knockout phenotypes

    • Introduce orthologues from other species to assess functional conservation

    • Supplement with heme degradation products to test the hypothesis that these metabolites are essential

The unexpected finding that SLC48A1/HMOX1 double mutations cause significant embryonic lethality despite hemozoin sequestration illustrates the complexity of these pathways and the importance of rigorous genetic approaches .

What are the promising applications of SLC48A1 research for understanding hematological disorders?

Research on SLC48A1 opens several promising avenues for understanding and potentially treating hematological disorders:

  • Hereditary hemochromatosis and iron overload conditions:

    • SLC48A1-deficient mice demonstrate a novel mechanism for tolerating heme accumulation through hemozoin formation

    • This pathway could be therapeutically relevant for conditions involving toxic heme accumulation

    • Investigating whether hemozoin formation can be pharmacologically induced in patients with heme overload disorders

  • Anemia of chronic disease and inflammation:

    • The heme-iron recycling function of SLC48A1 suggests potential involvement in inflammatory anemias

    • Studying how inflammatory signals regulate SLC48A1 expression and function

    • Developing approaches to enhance SLC48A1 activity to improve iron availability during chronic inflammation

  • Erythrophagocytosis disorders:

    • SLC48A1 plays a critical role in processing heme from phagocytosed erythrocytes

    • Defects might contribute to macrophage dysfunction in hemophagocytic syndromes

    • Therapeutic targeting of this pathway could improve macrophage function in these disorders

  • Transfusional iron overload:

    • Patients receiving chronic transfusions develop iron overload with potential heme toxicity

    • Understanding SLC48A1-dependent pathways might inform better management strategies

    • Pharmacological induction of hemozoin formation could potentially reduce heme toxicity

These translational applications require further research on the regulation of SLC48A1 expression, post-translational modifications affecting its function, and the physiological consequences of hemozoin formation in mammals.

How can the structural distinctiveness between mammalian and parasitic SLC48A1/HRG-1 be exploited for antiparasitic drug development?

The structural distinctiveness between mammalian SLC48A1 and parasitic HRG-1 orthologues presents an opportunity for selective antiparasitic drug development:

  • Structural basis for selectivity:

    • Comparative modeling shows clear structural differences between mammalian and parasitic HRG-1 orthologues (RMSD values ≥1.257)

    • Despite these differences, the amino acid residues directly involved in heme transport remain conserved across species

    • Targeting parasite-specific structural elements adjacent to these conserved regions could provide selectivity

  • Experimental approaches for drug discovery:

    • High-throughput screening using parasite growth inhibition in the presence of heme

    • Structure-based virtual screening targeting parasite-specific binding pockets

    • Fragment-based drug discovery focusing on allosteric sites

    • Development of peptidomimetics that interfere with parasite-specific protein-protein interactions

  • Validation strategies:

    • GaPPIX (gallium protoporphyrin IX) sensitivity assays to confirm target engagement

    • RNAi-mediated knockdown to validate essentiality in parasite models

    • Cross-species complementation to test selectivity

    • In vivo efficacy studies in relevant animal models

The essentiality of HRG-1 for parasite survival has been demonstrated through RNAi experiments showing significant reduction in larval viability and development . This, combined with the structural distinctiveness from host orthologues, makes it a promising target for selective antiparasitic therapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.