Recombinant Mouse Hereditary hemochromatosis protein homolog (Hfe)-VLPs

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics of HFE

The hemochromatosis gene (HFE) was discovered in 1996, more than a century after clinical manifestations of hemochromatosis were first documented. Located on chromosome 6p and linked to the major histocompatibility complex (MHC), HFE encodes an MHC class I-like protein that binds to beta-2 microglobulin . The HFE protein consists of alpha1-alpha3 domains followed by a transmembrane domain and a short cytoplasmic domain, structurally resembling other MHC class I proteins .

In its functional form, HFE forms a heterodimeric complex with beta-2 microglobulin, which is essential for its proper trafficking to the cell surface . The protein plays a critical role in iron metabolism by modulating the expression of hepcidin, the primary controller of systemic iron homeostasis . HFE operates predominantly through interaction with the bone morphogenetic protein (BMP) type I receptor ALK3, as demonstrated through in vivo experiments where HFE overexpression in control mice resulted in increased hepatic hepcidin levels and iron deficiency anemia, effects that were absent in hepatocyte-specific ALK3-deficient mice .

The most significant mutation in HFE associated with hereditary hemochromatosis is C282Y (c.845G>A), which disrupts a disulfide bond in the α3 domain, leading to protein misfolding, lack of association with β2-microglobulin, and failure to reach the cell surface . This mutation accounts for approximately 85% of hereditary hemochromatosis cases, particularly in populations of Northern European descent .

Virus-Like Particles as Delivery Systems

Virus-like particles (VLPs) are non-replicative vectors that have emerged as powerful tools for the delivery of heterologous epitopes. These structures retain the structural characteristics of viruses without containing viral genetic material, making them safe yet highly immunogenic platforms . VLPs are considered among the most potent inducers of both cellular and humoral immune responses in experimental models .

The interaction between VLPs and the immune system begins with their recognition by pattern recognition receptors (PRRs) on dendritic cells (DCs), particularly C-type lectin receptors (CLRs), Toll-like receptors (TLRs), and Fc-gamma receptors (FcγRs) . This recognition triggers receptor-mediated endocytosis, followed by processing of VLP components for antigen presentation through either the MHC class I pathway (cross-presentation) or MHC class II pathway .

Table 1: Pattern Recognition Receptors Involved in VLP Recognition

Receptor TypeExamplesRole in VLP Processing
C-type Lectin Receptors (CLRs)Langerin, DC-SIGNRecognize carbohydrate structures on VLPs
Toll-like Receptors (TLRs)TLR2, TLR4, TLR9Recognize pathogen-associated molecular patterns
Fc-gamma Receptors (FcγRs)FcγRI, FcγRIIMediate uptake of antibody-bound VLPs

The effectiveness of VLPs in stimulating immune responses depends on several factors, including their size (typically 20-200 nm), repetitive surface structure, and ability to be efficiently taken up by antigen-presenting cells . These properties make VLPs ideal candidates for vaccine development and therapeutic delivery systems.

Development of Recombinant Mouse HFE-VLPs

The creation of Recombinant Mouse Hereditary hemochromatosis protein homolog (Hfe)-VLPs involves the expression of the mouse HFE protein and its incorporation into virus-like particles. While direct literature on this specific construct is limited, the approach can be understood through existing research on recombinant HFE expression and VLP technology.

Recombinant mouse HFE protein has been successfully produced in bacterial expression systems and mammalian cell lines. For instance, mice transgenic for HLA-B27 and human beta-2 microglobulin have been immunized with bacterially produced HFE, refolded with human beta-2 microglobulin, to generate antibodies against the protein . Commercial sources also offer recombinant HFE protein produced in E. coli systems .

The development of HFE-VLPs would likely follow established methodologies for incorporating foreign proteins into VLP platforms. This could involve:

  1. Genetic fusion of HFE sequences to VLP structural proteins

  2. Chemical conjugation of recombinant HFE to pre-formed VLPs

  3. Co-expression of HFE with self-assembling VLP proteins

For hepatocyte-specific delivery, recombinant adeno-associated virus (AAV) vectors have shown promise. Studies have utilized AAV2/8 for hepatocyte-specific expression of HFE in mice, demonstrating that this approach can effectively increase HFE and hepcidin mRNA levels while lowering hepatic iron and transferrin saturation .

Functional Applications in Iron Metabolism Research

Recombinant Mouse HFE-VLPs provide valuable tools for investigating iron metabolism and the molecular mechanisms underlying hereditary hemochromatosis. These constructs enable researchers to study:

  1. HFE-mediated regulation of hepcidin expression

  2. Formation and functionality of the HFE/TfR2 complex

  3. Interaction between HFE and the BMP signaling pathway

  4. Tissue-specific effects of HFE in iron homeostasis

Studies using AAV-mediated HFE expression in HFE-null mice have demonstrated that even subphysiological levels of HFE expression (approximately 3-fold lower than wild-type) can significantly improve iron parameters . The expression of HFE in HFE-null mice increased hepcidin mRNA and protein levels, decreased liver non-heme iron content, and reduced transferrin saturation .

Table 2: Effects of Recombinant HFE Expression in Mouse Models

ParameterHFE-null MiceHFE-null + AAV-HFEWild-type
Hepatic HFE mRNAUndetectable~33% of WT100%
Hepcidin mRNALowIncreasedNormal
Liver Iron ContentHighDecreasedNormal
Transferrin SaturationHighDecreasedNormal

Comparative Hematological Parameters in HFE Research

Hematological analyses provide crucial data on the effects of HFE deficiency and restoration. Studies in HFE-knockout (HFE-KO) mice have revealed several notable differences compared to wild-type counterparts, which could potentially be normalized through HFE-VLP interventions.

Table 3: Comparative Hematological Parameters in Different Mouse Models

ParameterWild-type (12 months)HFE-KO (2 months)HFE-KO (5 months)HFE-KO (12 months)HAMP-KO (2 months)
Hemoglobin (g/dL)15.2 ± 0.216.6 ± 0.216.2 ± 0.315.7 ± 0.315.7 ± 0.1
RBC (×10⁶/μL)11.0 ± 0.110.2 ± 0.19.8 ± 0.29.9 ± 0.29.9 ± 0.1
Hematocrit (%)49.7 ± 0.948.8 ± 0.746.9 ± 0.647.3 ± 0.746.7 ± 0.5
MCV (fL)45.2 ± 0.648.2 ± 0.347.9 ± 0.548.2 ± 0.747.0 ± 0.2
MCH (pg)13.9 ± 0.216.4 ± 0.116.5 ± 0.216.0 ± 0.315.7 ± 0.2
Reticulocytes (×10⁹/L)377 ± 28310 ± 10260 ± 17260 ± 35305 ± 75
Serum Iron (mg/dL)0.43 ± 0.091.36 ± 0.321.59 ± 0.251.87 ± 0.253.64 ± 0.48
Liver Iron (μg/g)153 ± 25219 ± 20233 ± 20310 ± 10NA
Transferrin Saturation (%)53 ± 1489 ± 1491 ± 1486 ± 14NA

Data from HFE-KO mice indicate enhanced erythropoiesis with elevated hemoglobin levels, mean corpuscular volume (MCV), and mean corpuscular hemoglobin (MCH), particularly in younger mice . These parameters, along with significantly increased serum iron, liver iron concentration, and transferrin saturation, reflect the systemic impacts of HFE deficiency on iron homeostasis.

Molecular Mechanisms of HFE-VLP Action

The potential efficacy of Recombinant Mouse HFE-VLPs relies on understanding the molecular mechanisms through which HFE influences iron metabolism. Research indicates that HFE functions primarily by:

  1. Modulating the BMP signaling pathway through interaction with ALK3

  2. Forming a complex with transferrin receptor 2 (TfR2)

  3. Regulating the expression of hepcidin in hepatocytes

The HFE/TfR2 complex appears to be critical for proper regulation of hepcidin expression, as evidenced by studies showing that mutations in either gene lower hepcidin levels . The observation that expressing HFE in TfR2-deficient mice or expressing TfR2 in HFE-null mice has no effect on liver or serum iron levels further supports the importance of this complex .

Therapeutic Potential and Gene Editing Approaches

Recent advances in gene editing technologies offer promising approaches for correcting HFE mutations. In a groundbreaking study, adenine base editing was used to correct the C282Y (c.845G>A) mutation in the Hfe gene in the 129-Hfetm.1.1Nca mouse model . Using the adenine base editor ABE7.10 delivered by an AAV8 split-vector, researchers achieved gene correction rates of approximately 10% with a single application of the therapeutic vector .

This intervention resulted in significant improvement of iron-associated parameters in both blood and liver tissue, demonstrating the potential of gene editing approaches for treating hereditary hemochromatosis . The development of HFE-VLPs could potentially enhance the delivery efficiency of such gene editing tools to hepatocytes.

For assessing editing efficiency, researchers have developed innovative reporter systems. One such system is the HFE-GFP switch-on system, which allows for the evaluation of gene editing through both GFP expression measurement via flow cytometry and next-generation sequencing . This dual read-out method provides precise quantification of editing efficiency among different guide RNAs.

Product Specs

Buffer
Lyophilized from phosphate-buffered saline (PBS) containing 6% trehalose, pH 7.4.
Form
Lyophilized powder
Note: The product will be shipped in lyophilized form with standard blue ice packs. Shipping in liquid form requires dry ice and necessitates prior communication. Additional fees will apply for dry ice and packaging.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Upon receipt, store the protein at -20°C or -80°C. Repeated freezing and thawing will compromise protein activity.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C or -80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged.
For specific tag types, please inquire about feasibility.
Synonyms
Hfe; Mr2; Hereditary hemochromatosis protein homolog
Datasheet & Coa
Please contact us to get it.
Expression Region
25-359aa
Research Area
Metabolism
Source
Mammalian cell
Species
Mus musculus (Mouse)
Target Names
Hfe
Target Protein Sequence
QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function

This protein binds to the transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Gene References Into Functions
  1. The H67D mutation in the HFE gene is associated with decreased susceptibility to manganese accumulation in the brain and reduced neurotoxicity from inhaled manganese. PMID: 27295312
  2. Aging HFE knockout mice on an SV129 genetic background offer a model for studying cardiomyopathy related to HFE gene mutations. PMID: 28558946
  3. Heterozygous, but not homozygous, HFE gene deletion disrupts glucose homeostasis without affecting lipid metabolism or liver injury. PMID: 27354540
  4. Single Hjv(-/-), and double Hfe(-/-)/Hjv(-/-) mice exhibit comparable iron overload, indicating that HFE and HJV regulate hepcidin through a shared pathway. PMID: 25609138
  5. HFE requires HJV to activate downstream signaling pathways for hepcidin regulation. PMID: 25608116
  6. Cholesterol metabolism alterations associated with H63D-HFE expression may contribute to Alzheimer's disease (AD) development. PMID: 24439478
  7. In vivo studies support the independent regulation of hepcidin by HFE and TFR2. PMID: 24155934
  8. HFE gene mutations are associated with altered brain iron profiles and increased oxidative stress in mice. PMID: 23429074
  9. HFE knockout mice did not exhibit higher brain iron levels compared to wild-type controls. PMID: 22466002
  10. HFE(-/-) retinal pigment epithelial cells showed slower senescence, higher survivin expression, faster migration, greater glucose uptake, and increased GLUT expression compared to wild-type cells. PMID: 23169885
  11. HFE plays a novel role in regulating the inflammatory response in the lung and in hereditary hemochromatosis. PMID: 22745741
  12. Double mutant mice lacking functional HFE or TFR2 and TMPRSS6 exhibited severe iron deficiency microcytic anemia, similar to single TMPRSS6 mutant mice, indicating that HFE and TFR2 are not TMPRSS6 substrates. PMID: 22244935
  13. Disruption of both HFE and TFR2 caused more severe hepatic iron overload with advanced lipid peroxidation, inflammation, and portal fibrosis than either single gene disruption. PMID: 22383097
  14. The HFE(-/-) mouse brain showed numerous significant changes in transcript levels, though few related to proteins directly involved in iron homeostasis. PMID: 22370144
  15. Loss of central and peripheral CD8+ T-cell tolerance to HFE in mouse models of human familial hemochromatosis. PMID: 22531912
  16. HFE(-/-) mice exhibit defective hepatic-intestinal iron and lipid signaling, predisposing them to diet-induced hepatic lipotoxicity and accelerated progression of injury to fibrosis. PMID: 21817060
  17. The HFE H63D mutant protein is associated with prolonged ER stress and increased neuronal vulnerability. PMID: 21349849
  18. Genetic loss of HFE or hepatic HFE overexpression did not modulate the hepcidin elevation and systemic iron deficiency of TMPRSS6(-/-) mice. PMID: 21355094
  19. HFE influences erythropoiesis through two mechanisms: limiting hepcidin expression under conditions of simultaneous iron overload and stress erythropoiesis, and impairing transferrin-bound iron uptake by erythroid cells. PMID: 21059897
  20. Transferrin receptor 2 (TFR2) and HFE are involved in holotransferrin-dependent signaling for furin regulation (involving ERK phosphorylation), which may control hepcidin expression. PMID: 20634490
  21. Hepcidin expression does not rescue the iron-poor phenotype of Kupffer cells in HFE-null mice after liver transplantation. PMID: 20338170
  22. HFE is limiting in the formation of the HFE/TFR2 complex that regulates hepcidin expression. PMID: 20177050
  23. Multiple pregnancies do not reduce body iron stores in HFE(-/-) mice. PMID: 20110460
  24. In HFE knockout mice, Hamp1 mRNA was decreased, and duodenal ferroportin mRNA expression was increased compared to wild-type animals. PMID: 19426170
  25. Prolyl-peptidyl isomerase, Pin1, phosphorylation is compromised in association with the HFE H63D polymorphic allele. PMID: 20060900
  26. HFE deficiency causes increased gene expression of hepatic acute-phase proteins and duodenal digestive enzymes. PMID: 19787063
  27. Iron uptake from plasma transferrin by the duodenum is impaired in the HFE knockout mouse. PMID: 11943867
  28. Mouse hemachromatosis protein (HFE) plays a minor role in down-regulation but does not influence the up-regulation of iron absorption. PMID: 12149232
  29. Evidence suggests that HFE regulates functional cross-talk between crypt and villus enterocytes. PMID: 12367579
  30. In normal and HFE knockout mice, duodenal nonheme iron content correlated with liver iron stores, independent of dietary iron levels. However, duodenal iron content was reduced in HFE knockout mice for any given liver iron store content. PMID: 12468424
  31. Mice lacking HFE or producing a C282Y mutant HFE protein develop hyperferremia and high hepatic iron levels. PMID: 12704388
  32. Oxidative damage was observed in colon and mammary tissue in null-mutant mice. PMID: 12706501
  33. No correlation was found between the expression levels of duodenal iron transporters DMT1 and IREG1 and liver iron content in HFE knockout mice. PMID: 14618243
  34. In mice, HFE deficiency is associated with the same iron overload pattern observed in patients with hereditary hemochromatosis. PMID: 14656876
  35. Rag1 deficiency in HFE knockout mice leads to heightened iron overload, primarily in the liver. PMID: 14656877
  36. The H67D mutation leads to partial loss of HFE function and contributes to murine hereditary hemochromatosis. PMID: 14673107
  37. HFE-deficient mice react normally to endotoxin, and their hepatocytes react normally to IL-6. PMID: 15192150
  38. Treatment of C57BL/6 HFE(-/-) mice with 15% ethanol for 6.5 months did not increase hepatic uroporphyrin. PMID: 15382179
  39. Overexpression of mouse HFE, but not human HFE, in a mouse transformed cell line significantly inhibits transferrin uptake, correlating with apoptotic cell death. PMID: 15389541
  40. These results are the first in a series of studies to understand how HFE mutations are a risk factor for AD. PMID: 15718038
  41. Reconstitution of HFE-deficient mice with wild-type bone marrow augmented splenic iron storage capacity, decreased liver iron loading, and significantly increased hepatic hepcidin mRNA levels. PMID: 15914561
  42. Direct recognition of mouse HFE molecules by cytotoxic T lymphocytes (CTLs) was demonstrated in DBA/2 HFE knockout mice. PMID: 16123136
  43. These results suggest that while HFE is necessary for establishing basal hepcidin levels… PMID: 16565419
  44. HFE and TFR2 interact in cells; this interaction is not abrogated by disease-associated mutations of HFE and TFR2; and TFR2 competes with TFR1 for HFE binding. PMID: 16893896
  45. The basolateral membrane localization of HFE and its interacting proteins, TFR1 and TFR2, in retinal pigment epithelium (RPE) is relevant to iron homeostasis regulation in this cell type. PMID: 17003411
  46. An inverse correlation exists between transferrin saturation and transferrin half-life for both HFE-deficient and wild-type mice, suggesting that HFE does not directly affect transferrin catabolism. PMID: 17116709
  47. In an alcohol-susceptible strain, HFE gene mutation diminished the response of iron indices to alcohol treatment. PMID: 17207112
  48. Rgmc regulation by LPS is HFE-independent. PMID: 17255318
  49. HFE is required for appropriate expression of the hepcidin, which controls intestinal iron absorption. PMID: 17264297
  50. HFE(-/-) mice show increased adiponectin levels and AMP-dependent kinase activation. PMID: 17971451
Database Links

KEGG: mmu:15216

STRING: 10090.ENSMUSP00000089298

UniGene: Mm.2681

Protein Families
MHC class I family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.