Recombinant Mouse Histamine H2 receptor (Hrh2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

The Hrh2 receptor mediates:

  • Gastric Acid Secretion: Activation stimulates adenylate cyclase, increasing cAMP and proton pump activity .

  • Immune Regulation: Modulates macrophage phagocytosis and Th1/Th2 polarization via cAMP and MAPK pathways .

  • Cardiovascular Effects: In non-murine models, H2R influences heart rate and contractility, though mouse hearts lack functional responses .

Table: Key Experimental Uses

ApplicationStudy FocusSource
Autoimmune Disease ModelsEAE (Experimental Autoimmune Encephalomyelitis)
Cancer TherapeuticsH2R agonist/antagonist effects on tumor growth
Receptor Signaling AnalysiscAMP and MAPK pathway interactions
Structural StudiesLigand binding and dimerization assays

Cross-Species Comparisons

The mouse Hrh2 shares 75% amino acid identity with human HRH2, enabling translational studies . Key differences include:

  • Ligand Binding Sites: Subtle variations affect agonist/antagonist specificity .

  • Tissue Expression: Murine Hrh2 is abundant in gastric mucosa, while human HRH2 is also expressed in the heart and immune cells .

Research Findings and Implications

  • Knockout Models: Hrh2⁻/⁻ mice exhibit gastric mucosal hypertrophy and impaired acid secretion, highlighting H2R's role in cellular homeostasis .

  • Therapeutic Targets: H2R antagonists (e.g., famotidine) are used for acid-related disorders, while agonists show potential in cancer immunotherapy .

  • Signaling Crosstalk: H2R interacts with H1R to modulate inflammatory pathways, suggesting dual-receptor targeting strategies .

Future Directions

  1. Cardiac Studies: Investigate why murine hearts lack functional H2R responses despite receptor expression .

  2. Structural Biology: Resolve cryo-EM structures to guide drug design .

  3. Microbiome Interactions: Explore gut microbiota-derived histamine effects on Hrh2 in colitis models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributor for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Hrh2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPNGTVHSCCLDSIALKVTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVMPFSAIYQLSFKWRFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIVCWFPYFTAFVYRGLRGDDPVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQ LFHCKLASHNSHKTSLRLNNSLLSRSQSREGRWQEEKPLKLQVWSGTELTHPQGSPVR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References Into Functions
  1. Activation of H2R or its downstream signaling molecules may represent a novel therapeutic target for chronic lung inflammatory diseases, especially when CD1d-mediated presentation of lipid antigens to iNKT cells contributes to the pathology. PMID: 28618071
  2. The ability of probiotic L. reuteri to suppress colitis depends on the presence of bacterial histidine decarboxylase gene(s) in the intestinal microbiome, the consumption of a histidine-containing diet, and signaling via the histamine H2 receptor (H2R). PMID: 26670383
  3. H2R is required for IL-6 and IL-17 mucosal responses to intestinal histamine-secreting microbes. PMID: 24954261
  4. Histamine facilitates memory retention of inhibitory avoidance in mice, non-linearly by H2 receptor activation. PMID: 24161893
  5. Data show that experimental allergic encephalomyelitis (EAE) severity in histamine H2 receptor (H2RKO) mice expressing H2R exclusively in T cells becomes equal to that in wild-type B6 mice only when pertussis toxin is used to elicit disease. PMID: 24371118
  6. H2R activation exacerbates myocardial I/R injury by promoting myocardial mitochondrial dysfunction and increasing cardiac vascular endothelial permeability. PMID: 23467745
  7. Data suggest that histamine stimulates proliferation of Leydig tumor cells via activation of HRH2 and a transient increase in intracellular cAMP levels. Normal/immature Leydig cells and progenitor Leydig cells exhibit very low levels of HDC expression. PMID: 23077168
  8. Histamine reduces the alpha-CD3-induced interferon-gamma (IFN-gamma) production of CD4+ cells via the histamine H-receptor. PMID: 22280069
  9. Data suggest that a combined pharmacological targeting of histamine H(1) and H(4) receptors could be considered as an option for the prevention of asthma and potentially other allergic diseases. PMID: 22272324
  10. A previously unidentified role for H2R establishes a synergy between endogenous histamine and interleukin (IL)-4 that supports eosinophilic recruitment to the lung. PMID: 22156496
  11. Histamine receptor 2 is not required for K/BxN serum-induced arthritis. PMID: 19762454
  12. Histamine synthesis in tumor tissues suppresses local tumor immunity via the H(2) receptors. PMID: 12372415
  13. Histamine H(2)-receptor deficient mice developed gastric pathophysiological changes resembling Menetrier's disease for up to 17 months of observation. PMID: 12686732
  14. Results suggest that histamine signaling through the histamine H(2) but not the H(1) receptor is important for controlling Y. enterocolitica infection within the Peyer's patches and mesenteric lymph nodes of mice. PMID: 16717182
  15. Our findings demonstrate that H2 receptors are involved in learning and memory processes for which the frontal cortex, amygdala and hippocampus interact. PMID: 17145090
  16. Histamine H2 receptors are upregulated during bone marrow regeneration in mice. PMID: 17420012
  17. HR2 immunoreactivity was observed on the processes and cell bodies of the primary glial cells of the mammalian retina, the Muller cells. PMID: 19015005
  18. Decreasing expression on the mast cells within skin lesions of MRL/lpr mice. PMID: 19162242
  19. Histamine has a direct suppressive effect on intestinal intraepithelial lymphocytes-derived cytokines via histamine H(2)receptor, which would have a crucial role in suppression of local immunoregulation in the intestinal epithelium. PMID: 19277450

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse Histamine H2 receptor?

Mouse H2 receptor consists of 359 amino acids and is located on chromosome 5 . The calculated molecular weight is approximately 40 kDa, although the observed molecular weight in experimental conditions is often around 111 kDa, likely due to post-translational modifications and protein-protein interactions . The receptor belongs to the G protein-coupled receptor family with seven transmembrane domains. Its structure allows for specific binding of histamine and other H2R agonists, initiating downstream signaling cascades that regulate various physiological processes including gastric acid secretion and immune cell function .

How does mouse Hrh2 signaling work at the cellular level?

Mouse H2 receptor primarily signals through the Gs protein, activating adenylyl cyclase to increase intracellular cAMP levels. This activation leads to protein kinase A (PKA) phosphorylation and subsequent modulation of downstream effectors . In cardiomyocytes, H2R activation can increase contractility through cAMP-dependent mechanisms affecting calcium handling. In immune cells, H2R signaling modulates cytokine production and cellular functions. For instance, H2R stimulation of Th2 cells can enhance IL-13 production, while it can also augment the suppressive activity of transforming growth factor-β on T cells . These diverse signaling pathways explain the pleiotropic effects of H2R activation observed across different physiological systems.

What are the key tissue expression patterns of Hrh2 in mice?

The expression pattern of H2R varies significantly across tissues and developmental stages in mice. While it is notably expressed in gastric parietal cells, cardiac tissue, and various immune cells including B cells and T cells, its functional expression shows interesting species-specific and age-dependent variations . For example, adult mouse cardiomyocytes do not express functional H2R, unlike other mammalian species. This is evidenced by the lack of histamine-induced increases in mechanical function in wild-type mouse hearts . In the immune system, H2R is expressed on various cell types including T cells, where it modulates cytokine production and immune responses .

Experimental Models and Tools

Validation of Hrh2 expression requires a multi-modal approach:

  • RT-PCR Analysis: Using specific primers for H2R gene detection, as demonstrated in knockout model verification studies. Primers targeting exonic regions can effectively distinguish between wild-type and mutant alleles .

  • Western Blotting: Using validated antibodies against H2R. When selecting antibodies, consider those recognizing epitopes within residues 179-224 of human HRH2 with cross-reactivity to mouse H2R .

  • Functional Assays: Measure cAMP accumulation following stimulation with H2R-specific agonists such as dimaprit or compound 16 .

  • Immunohistochemistry/Immunofluorescence: Using validated antibodies to localize H2R expression in tissue sections or cultured cells .

It's important to include appropriate positive and negative controls in all validation experiments, such as tissue from H2RKO mice as negative controls and tissues known to express high levels of H2R (e.g., gastric mucosa) as positive controls.

How do mouse models of Hrh2 deficiency affect gastric physiology?

H2R-deficient mice exhibit distinctive gastric phenotypes despite normal basal gastric pH:

These findings demonstrate that H2R signaling is essential for normal cellular homeostasis of gastric mucosa and properly formed secretory membranes in parietal cells, providing a valuable model for studying regulatory mechanisms of gastric acid secretion.

What role does Hrh2 play in immunological research?

H2R has significant immunomodulatory functions that make it relevant for immunological research:

  • T Cell Responses: H2R signaling influences T cell differentiation and cytokine production. H2RKO mice show blunted Th1 responses, and H2R stimulation can enhance IL-13 production in Th2 cells .

  • Autoimmune Disease Models: H2RKO mice show reduced susceptibility to experimental autoimmune encephalomyelitis (EAE), a model for multiple sclerosis, indicating H2R's role in autoimmune pathophysiology .

  • Immunosuppressive Effects: H2R signaling augments the suppressive activity of transforming growth factor-β on T cells and is required for ultraviolet B irradiation-induced systemic suppression of antigen-specific T-cell responses .

  • B Cell and T Cell Regulation: Pharmacological blockade of H2R decreases numbers of B cells and IL-2Rα (CD25) expressing T cells, with reduced serum levels of IL-2 persisting even after treatment cessation .

These findings highlight H2R as a potential target for immunomodulatory therapies and underscore the importance of considering immune effects when using H2R antagonists clinically.

How can I design experiments to study tissue-specific functions of Hrh2?

To investigate tissue-specific functions of H2R, consider these methodological approaches:

  • Conditional Knockout Strategies: Utilize the floxed H2R mouse model crossed with tissue-specific Cre recombinase-expressing mice. For example, to study H2R function specifically in endothelial cells, cross floxed H2R mice with mice expressing Cre under an endothelial-specific promoter .

  • Cell-Specific Transgenic Expression: Generate or use existing models with cell-specific H2R expression on an H2RKO background, similar to the T cell-specific expression model described in the literature . This approach allows you to determine if H2R expression in a single cell type is sufficient to rescue phenotypes observed in H2RKO mice.

  • Pharmacological Approach with Tissue-Specific Delivery: Use H2R agonists or antagonists with targeted delivery systems to affect specific tissues. For cardiovascular studies, compounds like apromidine or its derivatives (BU-E-75 and BU-E-76) have shown selective effects on cardiac function .

  • Ex Vivo Tissue Preparation: For cardiac studies, techniques like Langendorff-perfused heart preparations can isolate cardiac-specific effects of H2R modulation .

  • Bone Marrow Chimeras: To distinguish between hematopoietic and non-hematopoietic H2R functions, generate bone marrow chimeras between wild-type and H2RKO mice.

When designing these experiments, always include appropriate controls and validate the cell-specific deletion or expression of H2R using multiple techniques.

What are the contradictions in Hrh2 signaling data and how can they be resolved?

Several contradictions exist in the H2R signaling literature that warrant careful experimental design to resolve:

  • Species-Specific Differences: While H2R mediates positive inotropic effects in many mammalian species, adult mouse cardiomyocytes do not express functional H2R. This contradiction highlights the importance of species selection in cardiovascular H2R research . To resolve this, researchers should explicitly acknowledge species differences and avoid generalizing findings across species without validation.

  • Tissue-Specific Effects: Some H2R agonists like BU-E-75 and BU-E-76 induce positive inotropic effects without changing heart rate in intact guinea pig hearts, yet cause potent positive chronotropic effects in isolated guinea pig right atria . This apparent contradiction might reflect differences between isolated tissue preparations and intact organs. Multi-level experimental approaches (molecular, cellular, tissue, and whole-organ) are needed to resolve these discrepancies.

  • Pharmacological Specificity Issues: Many H2R agonists also activate other histamine receptors. For example, dimaprit stimulates H3- and H4-receptors more potently than H2-receptors . Researchers should employ multiple methodological approaches, combining pharmacological studies with genetic models, and use the most selective available compounds with appropriate controls.

  • Developmental Differences: The effects of H2R may vary during development, as suggested by the lack of functional H2R in adult mouse cardiomyocytes while it may be present in fetal cells . Age-matched controls and developmental time-course studies are essential to clarify these contradictions.

What are the current technical challenges in recombinant Hrh2 production and how can they be overcome?

Producing functional recombinant H2R presents several technical challenges:

  • Protein Folding and Membrane Insertion: As a G protein-coupled receptor, H2R requires proper folding and membrane insertion for functionality. Using specialized expression systems like insect cells (Sf9, Sf21) or mammalian cells with chaperone co-expression can improve proper folding.

  • Post-translational Modifications: The discrepancy between calculated (40 kDa) and observed (111 kDa) molecular weights suggests significant post-translational modifications . Expression systems capable of mammalian-like glycosylation patterns (e.g., CHO or HEK293 cells) may yield more physiologically relevant recombinant protein.

  • Protein Stability: GPCRs often have limited stability when extracted from membranes. Addition of stabilizing mutations, fusion partners (like T4 lysozyme), or nanobody co-expression can enhance stability for structural and functional studies.

  • Functional Validation: Confirming that recombinant H2R maintains proper ligand binding and signaling properties is essential. Establishing reliable functional assays (cAMP accumulation, β-arrestin recruitment, or GTPγS binding) is critical for quality control.

  • Purification Challenges: Adding affinity tags (His, FLAG) at positions that don't interfere with function facilitates purification. Detergent screening to identify optimal solubilization conditions while maintaining function is also crucial.

For researchers producing recombinant H2R, employing these strategies while carefully validating the functional properties of the recombinant protein at each step will help overcome these challenges.

How does Hrh2 signaling contribute to disease models beyond gastric pathologies?

H2R signaling has important implications in several disease models:

  • Autoimmune Disorders: H2RKO mice exhibit reduced susceptibility to experimental autoimmune encephalomyelitis (EAE), suggesting H2R's role in autoimmune pathogenesis. This finding aligns with observations of increased histamine levels in the cerebrospinal fluid of multiple sclerosis patients .

  • Cardiovascular Disorders: H2R signaling affects cardiac contractility and rhythm in several mammalian species. H2R antagonists have been investigated for potential benefits in chronic heart failure models. The species-specific differences in cardiac H2R expression must be considered when translating findings to human cardiovascular diseases .

  • Immune-Mediated Conditions: H2R blockade has immunomodulatory effects, decreasing B cells and IL-2Rα-expressing T cells while reducing serum IL-2 levels. These effects persist even after treatment cessation, highlighting potential impacts on vaccination responses and immunotherapy outcomes .

  • Cancer: Clinical reports have associated H2R blockade with clinical benefits in certain cancer settings, possibly through immunomodulatory mechanisms. The exact mechanisms remain to be fully elucidated but may involve alterations in immune surveillance and anti-tumor responses .

Understanding these diverse pathophysiological roles can guide research into novel therapeutic applications of H2R modulators beyond traditional gastric indications.

What methodological considerations are important when using Hrh2 knockout mice for immunological studies?

When utilizing H2RKO mice for immunological research, several methodological considerations are crucial:

  • Genetic Background Control: Always use littermate controls with identical genetic backgrounds, as immune phenotypes can vary significantly between mouse strains. Backcrossing to a consistent background (e.g., C57BL/6J) for at least 10 generations ensures genetic homogeneity .

  • Microbiome Influences: Housing conditions and microbiome composition can significantly affect immune responses. Co-housing experimental and control mice or using littermates helps minimize these variables .

  • Sex Differences: Include both male and female mice in studies, analyzing data by sex, as immune responses can differ significantly between sexes.

  • Age Considerations: Age-match experimental groups precisely, as immune function changes with age. This is particularly important when studying chronic conditions or age-dependent immune responses.

  • Cell-Specific vs. Systemic Effects: Consider using conditional knockout models or bone marrow chimeras to distinguish between immune cell-intrinsic effects and secondary effects due to altered systemic physiology .

  • Comprehensive Immune Phenotyping: Employ multi-parameter flow cytometry panels to assess multiple immune cell populations simultaneously. Include assessments of both innate and adaptive immunity.

  • Functional Assays: Beyond phenotyping, include functional assays such as antigen-specific T cell responses, cytokine production profiles, and in vivo immune challenge models .

  • Consideration of Compensatory Mechanisms: Genetic knockouts may develop compensatory mechanisms that mask phenotypes. Acute pharmacological inhibition studies can complement genetic approaches to address this issue .

What emerging technologies could advance our understanding of mouse Hrh2 functions?

Several cutting-edge technologies could significantly enhance Hrh2 research:

  • CRISPR-Cas9 Base Editing and Prime Editing: These techniques allow precise modification of specific amino acids without double-strand breaks, enabling detailed structure-function studies of H2R signaling domains.

  • Single-Cell Transcriptomics: Analyzing H2R expression and downstream signaling effects at single-cell resolution can reveal cell type-specific roles and heterogeneity in H2R responses, particularly within immune cell populations.

  • Spatial Transcriptomics: These methods preserve spatial information while providing transcriptomic data, allowing researchers to understand H2R expression and activity within tissue microenvironments.

  • Optogenetic and Chemogenetic Control: Developing light- or ligand-activated H2R variants would allow temporal and spatial control of receptor activity in specific cell populations.

  • Cryo-EM for Structural Studies: Recent advances in cryo-electron microscopy could facilitate determination of mouse H2R structure in various conformational states and in complex with different ligands or signaling partners.

  • Organoid Models: Gastric, immune, or cardiac organoids derived from wild-type or genetically modified mouse stem cells could provide physiologically relevant 3D models for studying H2R function.

  • Intravital Imaging: Using fluorescent H2R sensors or reporters combined with multiphoton microscopy could allow real-time visualization of H2R activity in living tissues.

These technologies, particularly when combined, have the potential to resolve current contradictions in the literature and provide unprecedented insights into H2R biology.

How can contradictions in cross-species Hrh2 function be systematically addressed?

To systematically address cross-species differences in H2R function, researchers should consider:

By implementing these approaches, researchers can develop a clearer understanding of genuine species differences in H2R function versus experimental artifacts, advancing the translational relevance of mouse H2R research for human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.