Recombinant Mouse Histamine H3 receptor (Hrh3)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant mouse histamine H3 receptor (HRH3) is a genetically engineered version of the native murine H3 receptor, cloned and expressed in heterologous systems to study its structure, pharmacology, and functional roles. This receptor belongs to the G-protein-coupled receptor (GPCR) family and plays critical roles in modulating neurotransmitter release in the central nervous system (CNS). Its recombinant form enables precise analysis of isoform-specific functions, ligand binding, and signaling mechanisms, which are pivotal for therapeutic development targeting neurological disorders.

Structure and Isoforms

The mouse HRH3 receptor exhibits structural diversity due to alternative splicing, generating multiple isoforms with distinct pharmacological and functional properties. Key isoforms include:

IsoformLength (aa)Key DeletionsFunctional Characteristics
mH3R-445445NoneFull-length; high intrinsic activity
mH3R-413413Segment D (ΔR274-S305)Higher agonist affinity, lower intrinsic activity
mH3R-397397Segment D + part of EIntermediate affinity; reduced G-protein coupling
mH3R-407407Segment D + C-terminal extensionAltered signaling pathways (e.g., MAPK)

These isoforms differ in third intracellular loop (ICL3) regions, which influence G-protein coupling and constitutive activity. For example, mH3R-413 lacks a 48-amino-acid segment, affecting agonist binding and effector coupling .

Pharmacological Profile

Recombinant mouse HRH3 isoforms exhibit distinct ligand-binding properties:

LigandmH3R-445 Affinity (pKi)mH3R-413 Affinity (pKi)mH3R-397 Affinity (pKi)
Histamine~8.0~8.5~8.2
Methimepip (Agonist)~7.5~8.0~7.8
Thioperamide (Antagonist)~9.0~9.5~9.2

Data adapted from and

  • Agonist Activity: mH3R-445 shows higher intrinsic activity compared to truncated isoforms, which exhibit reduced G-protein coupling .

  • Constitutive Activity: Basal signaling in the absence of agonists has been observed in recombinant systems, with isoform-dependent variability .

Signaling Pathways

The recombinant mouse HRH3 couples to Gαi/o proteins, inhibiting adenylate cyclase (AC) and reducing cAMP production. Additional pathways include:

  • MAPK Activation: Phosphorylation of extracellular signal-regulated kinases (ERK) via alternative signaling routes .

  • GSK-3β/Akt Regulation: Modulation of neuroprotective pathways linked to neuronal survival .

5.1. Neurotransmitter Modulation

Recombinant HRH3 isoforms inhibit the release of multiple neurotransmitters, including:

NeurotransmitterMechanismRelevance
GlutamatePresynaptic inhibition via Ca²⁺ channelsCognitive deficits in neurodegenerative diseases
DopamineHeteroreceptor-mediated suppressionAttention-deficit hyperactivity disorder (ADHD)
GABAAutoreceptor feedback inhibitionEpilepsy and anxiety

5.2. Impact of Prenatal Ethanol Exposure (PAE)

PAE alters HRH3 isoform expression and function:

  • mH3R-445 vs. mH3R-413: PAE increases GTPγS binding in hippocampal slices, suggesting enhanced H3R-effector coupling .

  • Sex-Specific Effects: PAE-induced changes in HRH3 mRNA levels (e.g., dentate gyrus) differ between male and female mice .

Research Applications

Recombinant mouse HRH3 is used in:

  1. Drug Discovery: Screening inverse agonists/antagonists for CNS disorders (e.g., pitolisant for narcolepsy) .

  2. Isoform-Specific Studies: Comparing signaling efficiency (e.g., mH3R-445 vs. mH3R-413) in cell lines .

  3. Neurotoxicity Models: Assessing ethanol-induced dysregulation of HRH3-mediated neurotransmission .

Challenges and Limitations

  • Low Protein Abundance: Detecting endogenous HRH3 protein in native membranes remains challenging due to low expression .

  • Species-Specific Variations: Mouse HRH3 shows higher agonist affinity for histamine compared to human isoforms but lower affinity for antagonists like thioperamide .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Hrh3; Histamine H3 receptor; H3R; HH3R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR RAFTKLLCPQKLKVQPHGSLEQCWK
Uniprot No.

Target Background

Function
The H3 subclass of histamine receptors plays a role in mediating histamine signaling within the central nervous system (CNS) and peripheral nervous system. It functions through inhibition of adenylate cyclase and exhibits significant constitutive activity (spontaneous activity in the absence of an agonist).
Gene References Into Functions
  1. The H3 receptor in the dorsal striatum contributes to repetitive behavioral pathologies. PMID: 28117842
  2. Activation of the H3R with the agonist R-(-)-alpha-methylhistamine elicits a unique time- and cell type-dependent profile of molecular signaling events in the striatum. PMID: 27510032
  3. The H3R is a critical regulator of sensorimotor gating, and the absence of H3R significantly modifies striatal dopaminergic function. PMID: 26945087
  4. Research indicates that knockout of the histamine receptor H3 (Hrh3 receptor) leads to a substantial reduction in free-running activity rhythm amplitude. PMID: 26660098
  5. These findings suggest that the H3 receptor may be involved in maintaining a relaxed state and preventing over-contraction in mature differentiated myotubes. PMID: 25746421
  6. Histamine H3 receptors are expressed in mouse beta cells and may play a role in insulin secretion and potentially beta cell proliferation. PMID: 24117016
  7. Polymorphisms in the Hrh3 gene have been observed between EAE-susceptible and resistant SJL and B10.S mice. PMID: 23894272
  8. Histamine H3 knockout mice exhibit greater increases in slow wave sleep compared to wild-type mice, consistent with enhanced histamine transmission. PMID: 23303066
  9. ZEL-H16 is a novel and potent nonimidazole agonist of H3R, which could serve as a pharmacological tool for future research or potentially as a therapeutic agent for H3R-related conditions. PMID: 22870296
  10. Evidence supports a role for the histamine H3 receptor in alcohol-related behaviors, particularly in alcohol consumption and alcohol reward. PMID: 21654737
  11. An increased expression of H3 receptors has been observed in HDC KO mice without any changes in the spontaneous firing of "histaminergic" neurons in the absence of histamine or their responses to the H3 receptor agonist (R)-alpha-methylhistamine. PMID: 21710252
  12. These findings demonstrate that manipulating central histamine H3 receptors with proxyfan can significantly improve glucose excursions by increasing plasma insulin levels through a glucose-independent mechanism. PMID: 21239440
  13. D(1)-H(3) receptor heteromers function as integrators of dopamine- and histamine-related signals, involved in regulating the activity of striatal neurons in the direct striatal pathway. PMID: 21173143
  14. This review suggests that conditioned place preference induced by alcohol is stronger in histidine decarboxylase-deficient mice compared to control mice. PMID: 20864504
  15. Behavioral changes induced by methamphetamine and MDMA in Hrh3 knockout mice have been reported. PMID: 19783867
  16. This study aimed to investigate the effects of essential splice signals on intron retention in histamine H3 receptors and to identify sequence elements that determine the differences in splicing between rats and mice. PMID: 19446035
  17. These results indicate that neuronal histamine is a mediator of body-weight homeostasis and that neuronal histamine functions through H3 receptors in mice. PMID: 12488429
  18. Norepinephrine release from the ischemic heart is significantly enhanced in mice lacking histamine H3 receptors. PMID: 12527809
  19. Data supports a protective antiarrhythmic role for histamine H(3)-receptors in myocardial ischemia. PMID: 12810089
  20. These findings support a role for H3Rs in mediating histamine effects on spatial learning and memory, as well as measures of anxiety. PMID: 15078574
  21. Activation of histamine H3 receptors hyperpolarizes the substantia nigra pars reticulata, thus decreasing the intensity of basal ganglia output. [histamine h3 receptor] PMID: 16738217
  22. Brain H3Rs play a pivotal role in drinking behavior in response to dehydration and AT-II. PMID: 16887177
  23. Central Hrh3 signaling negatively regulates susceptibility to autoimmune inflammatory disease of the CNS. PMID: 17548817
  24. These results suggest distinct roles for histamine H(3) receptors in various orexigenic pathways. PMID: 18037404
  25. Research highlights the involvement of histamine H3 receptors in experimental allergic rhinitis in mice. PMID: 18845911
  26. Histamine H(3) receptor-mediated signaling protects mice from cerebral malaria. PMID: 19547708
  27. Stimulation of H3R may have a neuroprotective effect, which could contribute to understanding the impact of H3R signaling in the central nervous system. PMID: 19549072
  28. H3 protein expression has been identified in vestibular neurons of mice characterized by large and roundish soma, which also stain for calretinin and calbindin. PMID: 19563635

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

[Basic] What is the mouse histamine H3 receptor and how does it compare structurally to human and rat orthologs?

The mouse histamine H3 receptor (Hrh3) is a G-protein-coupled receptor that belongs to the same family as the other histamine receptors (H1, H2, and H4). Like its counterparts in other species, the primary mouse H3 receptor isoform consists of 445 amino acids . The mouse H3 receptor shows high sequence homology to the rat H3 receptor (>90% identity) , which itself has 93% identity to the human H3 receptor . Despite this high sequence conservation, there are notable species-specific pharmacological differences that researchers must consider when designing experiments .

Multiple functional isoforms of the mouse H3 receptor have been identified, including H3(445), H3(413), and H3(410) . The mouse, like the rat, does not appear to express the H3(365) isoform that is prominent in humans . These species differences in isoform expression can significantly impact experimental outcomes when translating between rodent models and human applications.

[Advanced] How do mouse H3 receptor isoforms differ in their signaling properties and how should researchers account for this in experimental design?

Mouse H3 receptor demonstrates isoform-dependent differences in signaling pathways similar to those observed in human and rat models. The primary mouse isoforms (H3(445), H3(413), and H3(410)) display differential coupling to various signal transduction pathways . When designing experiments using recombinant mouse H3 receptor, researchers should consider:

  • The specific isoform being expressed in their recombinant system

  • The potential for differential activation of signaling pathways including:

    • Gαi/o-protein-coupled inhibition of adenylate cyclase

    • Stimulation of GTPγS binding

    • Phospholipase A2 activation

    • Mitogen-activated protein kinase (MAPK) pathways

    • GSK-3β and Akt signaling

For comprehensive investigation, researchers should implement assays that measure multiple signaling endpoints rather than relying on a single readout. This approach provides a more complete profile of H3 receptor function across different experimental conditions.

[Basic] What expression systems are most suitable for recombinant mouse H3 receptor studies?

The optimal expression system for recombinant mouse H3 receptor depends on the experimental objectives:

  • Mammalian cell lines: SK-N-MC neuroblastoma cells have been successfully used for transfection and expression of the rat H3 receptor , and similar approaches work well for mouse H3 receptor. These cells provide appropriate post-translational modification machinery and can be used to study cAMP inhibition in response to H3 agonists.

  • Detection methods: Several complementary techniques should be employed to confirm successful expression:

    • Northern blot analysis can detect H3 receptor mRNA (typically showing a 2.7-kb band in rodent brain tissue)

    • RT-PCR for identification of specific isoforms

    • Radioligand binding assays using N-[³H]methylhistamine, which binds with high affinity (Kd ~0.8 nM for rat receptor)

    • Functional assays measuring inhibition of forskolin-stimulated cAMP formation

[Advanced] What are the methodological considerations for detecting low-abundance H3 receptor isoforms in recombinant systems?

Detection of low-abundance mouse H3 receptor isoforms requires specialized approaches:

  • Isoform-specific RT-PCR: Design primers that target junction regions unique to specific isoforms. This technique has been used to detect various H3 receptor isoforms in mouse brain tissue .

  • Isoform-specific antibodies: Antibodies targeting unique epitopes in different isoforms have successfully detected H3 receptor isoform proteins in mouse brain . When using recombinant systems, these antibodies can verify expression of specific isoforms.

  • Functional discrimination: Different isoforms exhibit varying levels of constitutive activity and distinct signaling patterns. The H3(445) appears to be the predominant isoform in mice, similar to what has been observed in monkeys, where it is expressed in multiple brain regions including the frontal cortex, hippocampus, caudate, and hypothalamus .

[Basic] How does the pharmacological profile of mouse H3 receptor compare to human and rat receptors?

The pharmacological profile of mouse H3 receptor shows important species-specific differences that researchers must consider:

Table 1: Comparative Pharmacology of H3 Receptor Across Species

CompoundHuman H3(445)Rat H3(445)Mouse H3(445)
HistamineHighest affinityLower affinitySimilar to rat
Thioperamide (antagonist)Low affinity (Ki ~58 nM)High affinity (Ki ~4 nM)Similar to rat
Clobenpropit (antagonist)High affinity (Ki ~0.6 nM)High affinity (Ki ~0.4 nM)Similar to rat
Ciproxifan (antagonist)Lower affinityHigher affinitySimilar to rat

These pharmacological differences are particularly pronounced for certain antagonists like thioperamide, which shows approximately 14-fold higher affinity for the rat receptor compared to the human receptor . This represents a species difference in pharmacology rather than a different pharmacological subtype .

[Advanced] How should researchers design translational studies that account for species differences in H3 receptor pharmacology?

When conducting translational research with mouse H3 receptor models, implement these methodological safeguards:

  • Parallel testing: Validate compounds against both mouse and human recombinant H3 receptors to establish comparative pharmacology profiles. This approach reveals species-specific potency differences that might affect dose translation .

  • Pharmacophore analysis: Some compounds show unexpected pharmacological profiles, such as chloroproxyfan, which acts as a full agonist at the rat receptor but may have different properties at the mouse or human receptors .

  • Consider isoform differences: The absence of certain isoforms (like H3(365)) in mice compared to humans may impact the efficacy of compounds being tested . Researchers should determine which human isoform most closely corresponds to the functional properties of the mouse receptor being studied.

  • Binding vs. functional assays: Implement both binding assays (using N-[³H]methylhistamine) and functional readouts (cAMP inhibition, GTPγS binding) to provide comprehensive pharmacological profiles .

[Basic] What are the primary signaling pathways associated with mouse H3 receptor activation?

Mouse H3 receptor, like its human and rat orthologs, primarily couples to Gαi/o proteins and modulates multiple signaling pathways including:

  • Inhibition of adenylate cyclase: Resulting in decreased cAMP production, a common readout in recombinant systems

  • Stimulation of GTPγS binding: Indicating G-protein activation, which can be measured using radioligand binding assays

  • Activation of phospholipase A2: Leading to arachidonic acid release

  • MAPK pathway modulation: The H3 receptor activates mitogen-activated protein kinase in an isoform-dependent manner

  • GSK-3β and Akt signaling: H3 receptor activation influences these pathways involved in neuronal function and survival

[Advanced] How can researchers effectively study constitutive activity of recombinant mouse H3 receptor?

The mouse H3 receptor, like the human and rat receptors, exhibits constitutive activity independent of agonist stimulation . To effectively study this property:

  • Inverse agonist methodology: Use known H3 receptor inverse agonists to measure reversal of basal signaling activity. The degree of constitutive activity may vary between mouse H3 receptor isoforms, similar to human isoforms where H3(365) shows the highest constitutive activity .

  • Constitutive activity readouts: Monitor basal inhibition of neurotransmitter release or cAMP production in recombinant systems expressing mouse H3 receptor. Inverse agonists can reverse H3 receptor-mediated suppression of neurotransmitter release, providing a functional readout of constitutive activity .

  • Expression level considerations: Constitutive activity can be influenced by receptor expression levels. Establish stable cell lines with controlled receptor expression to ensure consistent results.

[Basic] What are the key considerations when developing cell-based assays with recombinant mouse H3 receptor?

When developing cell-based assays with recombinant mouse H3 receptor:

  • Expression system selection: Neuronal-derived cell lines often provide the most physiologically relevant background for H3 receptor studies. SK-N-MC cells have been successfully used for rat H3 receptor and are suitable for mouse receptor studies.

  • Transfection optimization: Optimize transfection conditions to achieve consistent expression levels, as variable expression can affect both constitutive activity and agonist responses.

  • Functional readouts: Implement multiple assay formats to comprehensively characterize receptor function:

    • cAMP inhibition assays (using forskolin stimulation)

    • [³H]methylhistamine binding assays (Kd ~0.8 nM based on rat data)

    • GTPγS binding assays to measure G-protein activation

    • Calcium mobilization with chimeric G-protein constructs

  • Controls: Include appropriate controls such as mock-transfected cells and cells expressing human H3 receptor for comparative analysis.

[Advanced] What methodological approaches should be used when working with H3 receptor knockout mice as experimental controls?

When utilizing H3 receptor knockout mice as controls in recombinant H3 receptor studies:

  • Knockout validation: Confirm the absence of H3 receptor expression using multiple techniques (RT-PCR, binding assays, immunohistochemistry) as compensatory expression of other isoforms may occur .

  • Conditional knockout considerations: Standard H3 receptor knockout mice may develop compensatory mechanisms that complicate data interpretation. Currently, conditional H3 receptor knockout mice are not widely available, but such models would provide more precise temporal control of gene deletion .

  • Phenotypic characterization: Thoroughly characterize the phenotype of knockout mice, noting that some unexpected results have been observed regarding arousal and food intake in H3-/- mice that contradicted expectations based on pharmacological studies with H3 receptor ligands .

  • Tissue preparation: When using tissues from knockout mice as negative controls for binding or functional studies, carefully match preparation conditions with wild-type samples to ensure valid comparisons.

[Basic] What are common pitfalls in interpreting pharmacological data from recombinant mouse H3 receptor studies?

Common pitfalls in data interpretation include:

[Advanced] How should researchers address discrepancies between in vitro recombinant mouse H3 receptor data and in vivo rodent model results?

When confronting discrepancies between recombinant receptor data and in vivo findings:

  • Integrative analysis approach: Compare pharmacological profiles across multiple systems:

    • Recombinant mouse H3 receptor in cell lines

    • Native H3 receptors in mouse brain tissue preparations

    • In vivo behavioral models

  • Isoform distribution consideration: The brain expresses multiple H3 receptor isoforms with region-specific distribution patterns. Recombinant systems typically express a single isoform, which may not recapitulate the complex isoform profile in specific brain regions .

  • Pharmacokinetic factors: In vivo efficacy depends on compound distribution, metabolism, and blood-brain barrier penetration. Poor in vivo results despite good in vitro activity may reflect pharmacokinetic limitations rather than pharmacodynamic failures.

  • Compensatory mechanisms: H3 receptor knockout mice studies have revealed unexpected results in some behavioral parameters, suggesting that compensatory mechanisms may develop in vivo that cannot be modeled in acute recombinant systems .

[Advanced] How can recombinant mouse H3 receptor be utilized to develop translational assays for neurological disorder drug discovery?

Recombinant mouse H3 receptor systems can be strategically employed for neurological drug discovery through:

  • Parallel screening platforms: Develop comparative screening using both mouse and human H3 receptor isoforms to identify compounds with consistent cross-species activity, increasing translational validity .

  • Disease-relevant signaling focus: Target H3 receptor signaling pathways implicated in specific disorders:

    • For attention-deficit hyperactivity disorder: Focus on neurotransmitter release modulation

    • For Alzheimer's disease: Examine GSK-3β and Akt signaling interactions

    • For obesity: Study food intake-related hypothalamic signaling

  • Isoform-specific targeting: Design assays that can identify compounds with differential activity across isoforms, potentially allowing for more precise therapeutic targeting with reduced side effects .

  • Integration with disease-specific models: Combine recombinant receptor data with disease-specific cellular models (such as neuronal cultures from disease model mice) to validate findings in more complex systems before advancing to in vivo studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.