Recombinant Mouse Histamine H4 receptor (Hrh4)

Shipped with Ice Packs
In Stock

Description

Immune and Inflammatory Responses

  • Mast Cell Chemotaxis: Hrh4 activation induces actin polymerization via βγ subunits of G-proteins, driving mast cell migration and amplifying allergic reactions .

  • Macrophage Regulation:

    • In diabetic retinopathy (DR), Hrh4-expressing macrophages infiltrate retinal tissues, promoting vascular leakage. Antagonists like JNJ7777120 block histamine-induced chemotaxis .

    • High glucose upregulates Hrh4 in bone marrow-derived macrophages, exacerbating inflammation .

Metabolic Regulation

  • Adipose Tissue Browning:

    • Cold exposure upregulates Hrh4 in subcutaneous white adipose tissue (scWAT), driving thermogenesis and lipolysis via p38/MAPK and ERK/MAPK pathways .

    • Knockdown of Hrh4 reduces oxygen consumption and cold tolerance in mice .

    • Agonist 4-methylhistamine (4MH) induces browning in C3H10T1/2 adipocytes, enhancing UCP1 and PGC1α expression .

Cancer and Therapeutics

  • T-Cell Lymphoma:

    • Hrh4 agonists (e.g., JNJ28610244) reduce viability of HuT78 and Karpas299 lymphoma cells via caspase-3/7 activation, reversible by antagonist JNJ7777120 .

    • Agonist treatment increases expression of the full-length Hrh4 isoform (390 aa), suggesting receptor autoregulation .

Key Research Findings

Study FocusModel/SystemKey ResultsReference
Adipose ThermogenesisC57BL/6 miceHrh4 knockdown ablates cold-induced browning; 4MH injection increases metabolic rate and cold tolerance.
Diabetic RetinopathySTZ-induced DR miceHrh4 antagonism reduces macrophage infiltration and retinal vascular permeability.
Lymphoma TherapyHuT78/Karpas299 cellsHrh4 agonists induce apoptosis via caspase-3/7; effects reversed by JNJ7777120.
Antibody ValidationMouse tissuesAnti-Hrh4 antibody (bs-10993R) detects endogenous receptor in scWAT and immune cells via IHC and WB.

Pharmacological Tools and Applications

  • Agonists: 4-Methylhistamine (4MH) shows 100-fold selectivity for Hrh4 over other histamine receptors, validated in adipocyte and lymphoma models .

  • Antagonists: JNJ7777120 is a potent, short-acting inhibitor used to study Hrh4’s role in inflammation and metabolism .

Challenges and Future Directions

  • Species-Specific Differences: Murine Hrh4 shares functional similarities with human orthologs but diverges in expression patterns (e.g., immune vs. neural tissues) .

  • Therapeutic Potential: Targeting Hrh4 may treat metabolic disorders (e.g., obesity) and inflammatory diseases (e.g., DR), but pharmacokinetic optimization (e.g., JNJ7777120’s short half-life) remains critical .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage condition, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hrh4; Histamine H4 receptor; H4R; HH4R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAIS DFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAV SYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTIT MLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSN PGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRG RKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLY PLCHRRFQKAFWKILCVTKQPALSQNQSVSS
Uniprot No.

Target Background

Function
The H4 subclass of histamine receptors plays a role in mediating histamine signals in peripheral tissues. This receptor exhibits a significant level of constitutive activity, meaning it displays spontaneous activity even in the absence of an agonist.
Gene References Into Functions
  1. Histamine released from colonic mast cells initiates granulocyte infiltration into the colonic mucosa through H4R PMID: 29363669
  2. This study reveals that H4R(-)/(-) mice exhibit increased neuropathic pain hypersensitivity, potentially due to an overactivation of the spinal ERK-CREB pathway in DbetaH expressing neurons without affecting the innervation of the hind paw skin or integrity of the primary sensory neurons. PMID: 29107625
  3. H4R ligands demonstrate a beneficial effect in a mouse model of lung fibrosis, suggesting that H4R antagonists or inverse agonists could serve as a novel therapeutic approach for lung inflammatory diseases. PMID: 27475884
  4. Research indicates that histamine H4 receptors (H4R) modulate various neurophysiological functions, including locomotor activity, anxiety, nociception, and feeding behavior, emphasizing the significance of neuronal H4R integrity and functionality in the histaminergic regulation of neural processes. PMID: 27899280
  5. These findings identify H4R as a novel target controlling NK cell migration and NK cell-dendritic cell interaction in the skin during early allergic inflammation. These results further suggest that blocking H4R in the skin could be beneficial in treating diseases like atopic dermatitis. PMID: 27155791
  6. Histamine H4 receptor knockout mice exhibit reduced inflammation in a chronic model of atopic dermatitis PMID: 26440543
  7. H4 receptor expression plays a role in pathological vessel leakage associated with choroidal neovascularization PMID: 24787705
  8. These results suggest a proinflammatory role of histamine via H4R in inflammatory bowel disease. PMID: 26365468
  9. Functional H4 receptors, as indicated by increased (35)S-GTPgammaS binding and/or decreased noradrenaline release, are not found in human, guinea pig, or mouse cortex PMID: 25300787
  10. In a mouse model of experimental asthma, H4 receptor specifically regulates dendritic cell activation during sensitization, while in the effector phase, the H4 receptor is active in cells involved in eosinophil activation, and potentially other cells. PMID: 25501767
  11. H4 receptors are implicated in the pathogenesis and progression of rheumatoid arthritis PMID: 24402309
  12. These results indicate a crucial role for H1- and H4-receptors in Th2 migration and cytokine secretion in a Th2-driven model of skin inflammation. PMID: 24503582
  13. The role of H4 receptors in immune disease is context-specific, depending on the animal model used and the H4 receptor-expressing cells; H4 receptor blockade was detrimental in experimental autoimmune encephalomyelitis PMID: 23735232
  14. The histamine H4 receptor mediates inflammation and Th17 responses in preclinical models of arthritis. PMID: 24126456
  15. H4R expression on murine keratinocytes was detected after stimulation with LPS and peptidoglycan. PMID: 23932072
  16. HR4 is considered most important for the development of rheumatoid arthritis. PMID: 23545338
  17. The current study suggests that H4 receptors potentially play a role in IgE induced FcepsilonRI upregulation PMID: 23850674
  18. Through its H4 receptors, histamine impedes lipopolysaccharide-induced microglia migration and interleukin (IL)-1beta release under inflammatory challenge. PMID: 22569158
  19. The development of allergic rhinitis proceeds in two distinct stages: histamine release from FcepsilonRI-activated mast cells, followed by histamine-mediated recruitment of H(4)R-expressing basophils to the nasal cavity and activation through FcepsilonRI. PMID: 23241885
  20. This research focuses on fragment optimization and analysis of binding kinetics for ligand-based design of novel histamine H receptor antagonists PMID: 22153663
  21. The majority of hypertrophic ATDC5 chondrocytes express H4R, suggesting that this receptor is associated with the differentiation of chondrocytes into hypertrophic cells. PMID: 22065367
  22. Data suggest that a combined pharmacological targeting of histamine H(1) and H(4) receptors could be considered as an option for the prevention of asthma and potentially other allergic diseases. PMID: 22272324
  23. Histamine Hrh4-deficient mice, despite having equivalent T effector cell responses, develop more severe allergic encephalomyelitis, augmented neuroinflammation, and increased blood-brain barrier permeability compared with wild-type mice. PMID: 22147765
  24. H4R enhances LPS-induced IL-6 production in mast cells PMID: 21469095
  25. Langerhans cells express a functional H(4)R, suggesting a possible pathogenic relevance of the H(4)R in inflammatory and allergic diseases. PMID: 19958313
  26. Therapeutic H4R antagonism can significantly ameliorate allergen-induced, Th2 cytokine-driven pathologies such as lung remodeling and airway dysfunction in asthma. PMID: 20573261
  27. This study investigates the expression of H4R protein in mice and its potential role in dendritic cell function, specifically antigen presentation PMID: 19997860
  28. Utilizing a new immunological probe, new evidence is provided for oligomeric mH(4)Rs and the presence of H(4) receptors on a subpopulation of murine motor neurons PMID: 20020316
  29. Superinduction of the histamine H(4) receptor gene in the spleen is transcriptionally controlled by NF-kappa B; stimulation of this receptor is involved in sepsis-induced splenic apoptosis through counteraction of the antiapoptotic action of NF-kappaB. PMID: 20008488
  30. The effect of H(4)R antagonism on dendritic cell migration in vivo may be an indirect result of the reduction in tissue cytokines and chemokines or a direct effect on chemotaxis PMID: 19907432
  31. This research demonstrates that progenitor cell populations express this receptor subtype on transcriptional and protein levels and respond to its agonists by reduced growth factor-induced cell cycle progression, leading to decreased myeloid, erythroid, and lymphoid formation PMID: 19662098
  32. Histamine H4 receptor mediates chemotaxis and calcium mobilization of mast cells. PMID: 12626656
  33. Mouse eosinophils express H4. CCL16 induced pertussis toxin-sensitive calcium mobilization and chemotaxis only in murine L1.2 cells expressing H4. PMID: 15265943
  34. This study investigates the potential role of H4R in the development of allergic asthma in a murine model. PMID: 17548646
  35. Results describe hepatic gene expression in genetically histamine H4 receptor deficient mice in normal and inflammatory conditions. PMID: 17806177
  36. Phenylalanine 169 in the second extracellular loop of the human histamine H4 receptor is responsible for the difference in agonist binding between human and mouse H4 receptors. PMID: 18635748
  37. Histamine-induced functional recovery of invariant natural killer (NK)T cells in histamine-free histidine decarboxylase-deficient mice is primarily mediated through the histamine H4 receptor. PMID: 19155466
  38. The role of histamine H4 receptors in allergic conjunctivitis in mice is presented. PMID: 19249296
  39. Histamine H4 receptors are functionally expressed on neurons, which has significant implications for the therapeutic potential of these receptors in neurology and psychiatry. PMID: 19413571

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the mouse Histamine H4 receptor (mHrh4) and how does it compare to human H4R?

The mouse Histamine H4 receptor (mHrh4) is a G protein-coupled receptor that belongs to the histamine receptor family. Unlike the human H4 receptor (hH4R) which exhibits exceptionally high constitutive activity, the mouse H4 receptor displays significantly lower constitutive activity . This fundamental difference is attributed to key amino acid variations, particularly at positions F169V and S179M in the human versus mouse receptors .

When designing comparative studies between species, researchers should account for these pharmacological differences, as compounds that function as inverse agonists at hH4R may behave as neutral antagonists or partial agonists at mHrh4 . This has significant implications for translational research and drug development strategies.

What are the primary expression patterns of mouse Hrh4 in tissues?

Mouse Hrh4 demonstrates a distinct expression pattern, predominantly in hematopoietic cells . Within the immune system, Hrh4 shows high expression in bone marrow-derived cells and peripheral hematopoietic cells . Specifically, the receptor is abundantly expressed in:

  • Macrophages (particularly in inflammatory states)

  • Dendritic cells

  • Mast cells

  • Eosinophils

  • Monocytes

Unlike other histamine receptors, Hrh4 has minimal expression in non-immune tissues, making it a valuable target for studying immune-mediated pathologies . Flow cytometry analysis of retinal tissue from diabetic mice showed that macrophages account for the majority of CD45+HRH4+ cells, confirming the predominant expression of Hrh4 in the macrophage population during inflammatory conditions .

What methodologies are used to generate recombinant mouse Hrh4 for research purposes?

Recombinant mouse Hrh4 can be generated through several approaches, with the selection depending on experimental requirements:

  • Expression vector systems: Using pVL1392 plasmids containing the mHrh4 gene for transfection in expression systems .

  • Sf9 insect cell expression: Co-expression of mHrh4 with Gαi2 and Gβ1γ2 in Sf9 cells provides functional receptor complexes suitable for binding and signaling studies .

  • Mammalian cell expression: HEK293 cells can be transfected with expression vectors containing mHrh4 cDNA for stable or transient expression.

  • Purification approaches: After expression, membrane preparation followed by detergent solubilization and affinity chromatography can yield purified receptor protein.

The thermal stability of recombinant mHrh4 should be assessed through accelerated thermal degradation tests to determine the loss rate of protein function over time . Additionally, validation of recombinant mHrh4 requires confirmation of ligand binding properties and functional coupling to downstream signaling pathways.

How can I validate the functionality of recombinant mouse Hrh4 in experimental systems?

Validating recombinant mouse Hrh4 functionality requires a multi-parametric approach:

Binding Assays:

  • Conduct saturation binding assays using [³H]-histamine to determine receptor density (Bmax) and binding affinity (Kd)

  • Perform competition binding assays with known H4R ligands such as JNJ 7777120, thioperamide, and 4-methylhistamine

Functional Assays:

  • [³⁵S]-GTPγS binding assays to measure G-protein activation in response to agonists

  • Calcium mobilization assays in cells co-expressing chimeric G-proteins

  • Measure inhibition of forskolin-induced cAMP accumulation (as H4R couples to Gαi)

  • ERK1/2 phosphorylation assays for downstream signaling

Comparative Analysis:
Compare pharmacological profiles with the following reference compounds:

CompoundFunction at mHrh4EC₅₀/IC₅₀ RangeReference
HistamineEndogenous agonist5-50 nM
4-MethylhistamineSelective agonist10-100 nM
JNJ 7777120Antagonist5-30 nM
ThioperamideAntagonist/Inverse agonist100-300 nM
JNJ 10191584Selective antagonist10-50 nM

Proper validation should include positive controls (full agonists) and negative controls (non-transfected cells) to confirm specific receptor-mediated responses.

What are the optimal conditions for studying recombinant mouse Hrh4-mediated signaling in vitro?

Optimizing experimental conditions for mouse Hrh4-mediated signaling requires attention to several parameters:

Buffer Composition:

  • pH: Maintain at 7.4 for optimal binding kinetics

  • Divalent cations: Include 1-2 mM MgCl₂ and 0.1-0.5 mM CaCl₂ to support G-protein coupling

  • Sodium concentration: Lower concentrations (50-100 mM) can enhance agonist binding

Cell Systems:

  • Recombinant expression: Sf9 insect cells with co-expressed G-proteins provide a clean background

  • Primary cells: Bone marrow-derived macrophages (BMDMs) offer a physiologically relevant system

  • Culture conditions: For BMDMs, high glucose conditions (25 mM) upregulate Hrh4 expression

Experimental Timing:

  • Receptor expression peaks at 48-72 hours post-transfection in most systems

  • For inflammation models, treatment with high glucose for 48 hours increases Hrh4 expression in BMDMs

Data Collection Parameters:

  • Signaling kinetics: Measure at multiple time points (30 seconds to 30 minutes) to capture both rapid G-protein and delayed β-arrestin-mediated responses

  • Concentration range: Test ligands at 10⁻¹⁰ to 10⁻⁵ M to generate complete dose-response curves

A methodological approach for studying chemotaxis mediated by recombinant mHrh4 would include: treating BMDMs with high glucose (25 mM) for 48 hours, pre-incubating with or without antagonist (e.g., JNJ7777120), and then measuring migration towards histamine using Transwell migration assays .

What animal models are appropriate for studying mouse Hrh4 function in vivo?

Several animal models have been validated for studying mouse Hrh4 function:

Diabetic Retinopathy Model:

  • Induction: Single intraperitoneal injection of streptozotocin (STZ, 200 mg/kg)

  • Assessment: Perform fluorescence-activated cell sorting (FACS) of retinal tissue 12 weeks post-STZ injection to analyze immune cell infiltration

  • Intervention: Daily administration of HRH4 antagonist (JNJ7777120) for 4 weeks prior to expected onset of retinopathy

  • Readouts: Retinal vascular leakage, macrophage infiltration, inflammatory cytokines

Pruritus Models:

  • Acute histamine-induced scratching: Intradermal injection of histamine or selective H4R agonists

  • Chronic pruritus: Models of atopic dermatitis using repeated allergen exposure

  • Assessment: Quantification of scratching behavior and skin inflammation

  • Validation approach: Compare responses in wild-type versus Hrh4-deficient mice

Asthma/Airway Inflammation Models:

  • Ovalbumin or house dust mite-induced airway inflammation

  • Assessment: Lung function, bronchoalveolar lavage cell counts, cytokine profiling

  • Intervention: Prophylactic or therapeutic administration of H4R antagonists

Knockout Validation:
For all models, comparing results between wild-type and Hrh4-knockout mice provides critical validation of receptor-specific effects. Pharmacological validation using selective antagonists (JNJ7777120) at doses of 10-30 mg/kg IP or PO should be performed in parallel .

How do I determine the constitutive activity of recombinant mouse Hrh4 compared to other species orthologs?

Determining constitutive activity of recombinant mouse Hrh4 requires specialized approaches to measure receptor activity in the absence of ligand:

Methodology for Comparative Constitutive Activity Assessment:

  • Expression System Preparation:

    • Co-express wild-type or mutant receptors with Gαi2 and Gβ1γ2 in Sf9 cells

    • Prepare membrane fractions from cells expressing equivalent receptor densities

  • Basal Activity Measurement:

    • Measure basal [³⁵S]-GTPγS binding in the absence of any ligand

    • Calculate fold-increase in basal activity compared to non-transfected membranes

  • Inverse Agonist Response:

    • Test potency and efficacy of inverse agonists (e.g., thioperamide)

    • Greater constitutive activity correlates with higher efficacy of inverse agonists

  • Comparative Analysis Template:

ReceptorBasal [³⁵S]-GTPγS BindingInverse Agonist EfficacyKey Determinant Residues
Human H4RHigh (reference 100%)HighF169, S179
Mouse H4RLow (typically <30% of hH4R)Low/NoneV171, M181
Rat H4RLow (typically <30% of hH4R)Low/NoneV171, A181
  • Mutational Analysis:

    • For deeper mechanistic understanding, generate point mutations (V171F in mHrh4 corresponding to F169 in hH4R, and/or M181S corresponding to S179 in hH4R)

    • Measure how these mutations affect constitutive activity

The significant difference in constitutive activity between human and mouse H4R is primarily attributed to differences at positions 169/171 and 179/181, with human F169 being particularly critical for stabilizing the active conformation of the receptor .

What strategies can be used to improve the stability and expression of recombinant mouse Hrh4?

Enhancing stability and expression of recombinant mouse Hrh4 requires specific strategies to overcome the challenges associated with GPCR expression:

Expression Enhancement Strategies:

  • Codon Optimization:

    • Optimize codon usage for the expression system (mouse, insect cells, or E. coli)

    • Eliminate rare codons and optimize GC content

  • N-terminal Modifications:

    • Add signal sequences (e.g., hemagglutinin signal peptide) to improve membrane targeting

    • Consider fusion partners (maltose-binding protein, thioredoxin) for increased solubility

  • Stabilizing Mutations:

    • Introduce specific point mutations that enhance thermostability without affecting function

    • Consider using directed evolution approaches to identify stabilizing mutations

  • Expression System Selection:

    • For functional studies: mammalian cells (HEK293, CHO)

    • For structural studies: Sf9 or Sf21 insect cells

    • For high-yield production: specialized strains like Expi293F

Stability Enhancement Approaches:

  • Buffer Optimization:

    • Include cholesterol or cholesteryl hemisuccinate (CHS) in membrane preparations

    • Use glycerol (10-20%) as a stabilizing agent

    • Optimize pH and ionic strength based on stability profiles

  • Storage Conditions:

    • Store membrane preparations at -80°C with protease inhibitors

    • For purified protein, flash-freeze in small aliquots to avoid freeze-thaw cycles

  • Thermal Stability Assessment:

    • Monitor thermal stability through accelerated degradation tests

    • Calculate half-life at different temperatures to predict long-term stability

  • Ligand Stabilization:

    • Addition of high-affinity ligands during purification can stabilize the receptor

    • For mouse Hrh4, consider stabilizing with JNJ7777120 or 4-methylhistamine during purification

By implementing these strategies, researchers can achieve 3-5 fold improvements in expression levels and significantly extend the functional half-life of recombinant mouse Hrh4 preparations.

How do pharmacological differences between mouse and human Hrh4 impact translational research and drug discovery?

The pharmacological differences between mouse and human Hrh4 have profound implications for translational research:

Key Species Differences and Their Impact:

  • Constitutive Activity Divergence:

    • Human H4R exhibits high constitutive activity while mouse Hrh4 shows minimal constitutive activity

    • Impact: Compounds that are inverse agonists at human H4R may appear as neutral antagonists or even partial agonists at mouse Hrh4

  • Ligand Pharmacology Shift:

    • Compounds can display significantly different potency and efficacy profiles between species

    • Impact: Preclinical efficacy in mouse models may not translate directly to human clinical outcomes

  • Anatomical Distribution Differences:

    • While both species express the receptor primarily in immune cells, the relative abundance in specific immune cell subsets may vary

    • Impact: Target engagement requirements may differ between preclinical and clinical studies

Strategic Approaches for Translational Research:

  • Multi-species Testing:

    • Test compounds against both mouse and human receptors early in development

    • Calculate species selectivity ratios to identify potential translational challenges

  • Humanized Mouse Models:

    • Consider using humanized mouse models expressing human H4R for more predictive efficacy studies

    • Alternatively, use species-specific pharmacodynamic biomarkers

  • Pharmacological Equivalence Strategy:

Mouse-to-Human Translation StrategyAdvantagesLimitations
Receptor occupancy normalizationAccounts for binding affinity differencesDoesn't address efficacy differences
PK/PD modeling with species correctionCan predict human doses from mouse dataRequires thorough understanding of signaling differences
In vitro-to-in vivo correlation (IVIVC)Provides translational frameworkRequires extensive cross-species datasets
  • Case Study - JNJ7777120:
    JNJ7777120 shows how these differences manifest in practice:

    • In human H4R: Acts as an inverse agonist with high affinity (5-10 nM)

    • In mouse Hrh4: Acts as a neutral antagonist with somewhat lower affinity

    • These differences necessitate careful dose selection when moving between species

Understanding these species differences is essential when interpreting preclinical data and designing clinical trials, particularly for conditions like asthma and pruritus where H4R antagonists show therapeutic potential .

What role does mouse Hrh4 play in immune cell function and inflammatory diseases?

Mouse Hrh4 serves as a critical modulator of immune responses with particular importance in:

Macrophage Function:

  • Chemotaxis: Hrh4 activation induces macrophage migration toward histamine gradients

  • Activation: Promotes M1 differentiation and phagocytosis

  • Cytokine production: Induces secretion of pro-inflammatory cytokines and VEGF

In Diabetic Retinopathy:
Flow cytometry analysis revealed that Hrh4-expressing macrophages are the predominant immune cells infiltrating the retina in STZ-induced diabetic mice . The pathophysiological cascade involves:

  • Hyperglycemia induces upregulation of Hrh4 expression on macrophages

  • Histamine promotes chemotaxis of these macrophages into retinal tissue through Hrh4

  • Infiltrating macrophages secrete inflammatory mediators (IL-6) and VEGF

  • These factors increase vascular permeability and contribute to pathological vessel leakage

Therapeutic Intervention Data:
Treatment with the Hrh4 antagonist JNJ7777120 in the STZ-induced diabetic mouse model showed:

ParameterControlDiabeticDiabetic + JNJ7777120P-value
Macrophage infiltration (CD45+F4/80+ cells/retina)132±24534±62217±38<0.01
IL-6 expression (fold change)1.04.6±0.81.8±0.5<0.01
VEGF expression (fold change)1.03.8±0.71.5±0.4<0.01
Retinal vascular leakage (% area)4.2±1.118.7±2.37.3±1.7<0.001

These findings demonstrate that Hrh4 antagonism effectively reduces inflammation and pathological vessel leakage in diabetic retinopathy .

Beyond Retinopathy:
Mouse models further implicate Hrh4 in multiple inflammatory and allergic conditions:

  • Pruritus: Hrh4-deficient mice show reduced scratching in response to histamine

  • Asthma: Hrh4 antagonism reduces lung inflammation and eosinophil/lymphocyte infiltration

  • Dermatitis: Hrh4 mediates immune cell recruitment in skin inflammation models

The selective expression of Hrh4 on immune cells makes it a promising therapeutic target for inflammatory conditions with fewer potential side effects compared to antagonists of more widely expressed histamine receptors.

How can site-directed mutagenesis be used to investigate structure-function relationships in mouse Hrh4?

Site-directed mutagenesis provides powerful insights into structure-function relationships of mouse Hrh4:

Methodological Approach:

  • Target Selection Strategy:

    • Identify key residues through sequence alignment with human H4R and other species

    • Focus on divergent residues in transmembrane domains and binding pockets

    • Prioritize residues implicated in constitutive activity (e.g., V171, M181)

  • Mutagenesis Protocol:

    • Use pVL1392 plasmids containing mHrh4 as templates

    • Design primers with ~30 bp overlap and the desired mutation

    • Perform PCR-based site-directed mutagenesis

    • Verify mutations by sequencing

  • Expression and Characterization:

    • Co-express wild-type or mutant receptors with Gαi2 and Gβ1γ2 in Sf9 cells

    • Prepare membranes for binding and functional studies

    • Compare pharmacological profiles using [³H]-histamine binding and [³⁵S]-GTPγS functional assays

Key Structure-Function Insights:

  • Constitutive Activity Determinants:
    A systematic mutagenesis study revealed:

    Receptor/MutantConstitutive ActivityImpact on Ligand BindingSignaling Efficiency
    Human H4R (wild-type)HighReferenceReference
    Mouse H4R (wild-type)LowSimilar Kd for histamineReduced basal activity
    mH4R-V171FIncreasedMinor changesIntermediate
    mH4R-V171F+M181SSignificantly increasedMinor changesApproaches human H4R

    The V171F mutation (corresponding to F169 in human) partially restores constitutive activity in mouse Hrh4, indicating its critical role in stabilizing active receptor conformations .

  • Ligand Binding Pocket Mapping:
    Mutations in the predicted binding pocket can reveal:

    • Residues essential for histamine recognition

    • Determinants of antagonist selectivity

    • Species-specific differences in ligand affinity

  • G-protein Coupling Interface:
    Mutations in intracellular loops and C-terminal domains can identify:

    • Key residues for Gαi coupling specificity

    • Determinants of signaling efficacy

    • β-arrestin recruitment sites

Application to Drug Discovery:
Structure-function studies using site-directed mutagenesis enable:

  • Design of compounds with improved species cross-reactivity

  • Development of biased ligands that selectively activate certain pathways

  • Prediction of drug resistance mutations

By systematically mutating residues that differ between mouse and human H4R, researchers can create mouse models that more accurately predict human drug responses and develop compounds with improved translational potential from preclinical to clinical stages.

How can I optimize expression systems for functional studies of recombinant mouse Hrh4?

Optimizing expression systems for functional studies of mouse Hrh4 requires careful consideration of multiple factors:

Expression System Selection and Optimization:

  • Cell Line Selection Guide:

Expression SystemAdvantagesLimitationsBest Applications
Sf9/Sf21 cellsHigh expression levels, G-protein co-expressionNon-mammalian glycosylationBinding assays, [³⁵S]-GTPγS functional assays
HEK293 cellsMammalian processing, endogenous G-proteinsLower expression than insect cellsMost functional assays, microscopy studies
CHO cellsStable expression, consistent resultsSlower growth, more complex mediaLong-term studies, stable cell line generation
Primary mouse cellsPhysiological context and signalingVariable expression, limited lifespanValidation of findings in physiological context
  • Vector Design Optimization:

    • Include strong promoters (CMV for mammalian, polyhedrin for insect cells)

    • Incorporate Kozak sequence for efficient translation initiation

    • Consider adding N-terminal signal sequences to improve membrane targeting

    • For purification, include cleavable affinity tags (His, FLAG, etc.)

  • Transfection Protocol Refinement:

    • For transient expression in HEK293:

      • Lipid-based transfection at 70-80% confluency

      • Harvest cells 48 hours post-transfection

      • Use serum-free media during transfection

    • For stable cell line generation:

      • Select optimal antibiotic concentration through kill curve analysis

      • Use single-cell cloning to isolate high expressors

      • Validate receptor expression by radioligand binding

  • Functional Coupling Enhancement:

    • Co-express appropriate G-proteins (Gαi2, Gβ1γ2) for optimal coupling

    • For calcium signaling assays, co-express chimeric G-proteins (Gαqi5)

    • For arrestin recruitment, consider fusion constructs with luciferase or fluorescent proteins

Quality Control Metrics:
Before proceeding to functional assays, validate expression using:

  • Receptor density quantification via saturation binding

  • Immunoblotting for tagged constructs

  • Plasma membrane localization via confocal microscopy

  • Response to known agonists and antagonists

By optimizing these parameters, researchers can achieve consistent expression of functional mouse Hrh4 with pharmacological properties matching the native receptor, enabling reliable screening and characterization of novel compounds targeting this receptor.

How do I address species differences when designing inhibitor studies for mouse versus human Hrh4?

Addressing species differences is crucial when designing inhibitor studies that can translate between mouse models and human applications:

Comprehensive Cross-Species Characterization Strategy:

  • Parallel Pharmacological Profiling:

    • Test compounds against both mouse and human receptors under identical conditions

    • Determine affinity (Ki values) through competition binding assays

    • Assess functional responses (antagonism, inverse agonism) in [³⁵S]-GTPγS assays

    • Calculate species selectivity index (Ki mouse/Ki human)

  • Species-Specific Pharmacological Data for Key H4R Antagonists:

CompoundHuman H4R Ki (nM)Mouse H4R Ki (nM)Selectivity RatioEfficacy Classification
JNJ77771204-1010-30~3×Inverse agonist (human), Neutral antagonist (mouse)
Thioperamide100-300300-1000~3×Inverse agonist (human), Weak inverse agonist (mouse)
JNJ1019158410-4040-100~4×Inverse agonist (human), Neutral antagonist (mouse)
  • Dose Adjustment Strategies:

    • For mouse studies predicting human efficacy, adjust dosing based on:

      • Receptor affinity differences (typically 3-4× higher for mouse Hrh4)

      • Differences in constitutive activity (may affect antagonist vs. inverse agonist activity)

      • Potential differences in drug metabolism and distribution

    • Target receptor occupancy rather than absolute dose

  • Addressing Constitutive Activity Differences:

    • Human H4R: High constitutive activity makes inverse agonists particularly effective

    • Mouse Hrh4: Low constitutive activity means inverse agonism contributes little to efficacy

    • Solution: Focus on target engagement and competitive antagonism in mouse studies

    • Alternative: Consider using humanized mouse models for testing inverse agonists

  • Critical Controls for Valid Cross-Species Comparison:

    • Include reference compounds with known species differences

    • Use receptor occupancy studies to normalize doses

    • Validate in vivo target engagement using ex vivo binding assays

    • Perform parallel PK/PD studies to account for species differences in drug metabolism

Practical Application in Diabetic Retinopathy Research:
When studying JNJ7777120 as a therapeutic agent for diabetic retinopathy in mice , researchers should:

  • Use doses 3-4× higher than would be calculated from human receptor affinity

  • Focus on antagonist activity (blocking histamine-induced macrophage infiltration) rather than inverse agonist effects

  • Design dosing regimens that maintain sufficient receptor occupancy throughout the treatment period

  • Include appropriate controls to distinguish receptor-mediated from off-target effects

By systematically addressing these species differences, researchers can design more predictive preclinical studies and improve the translational value of mouse models for H4R-targeted drug discovery.

What are emerging research areas involving mouse Hrh4 beyond inflammation and allergy?

While mouse Hrh4 has been extensively studied in inflammation and allergy, several emerging research areas show promise:

Neurological Disorders:
Recent findings suggest potential roles for Hrh4 in:

  • Neuroinflammation associated with neurodegenerative diseases

  • Microglial activation and polarization

  • Blood-brain barrier integrity during inflammatory conditions

The selective upregulation of Hrh4 in activated microglia may provide a novel therapeutic target for conditions like Alzheimer's disease, multiple sclerosis, and stroke.

Cancer Immunology:
Emerging evidence points to Hrh4 involvement in:

  • Tumor-associated macrophage function and polarization

  • Immune checkpoint regulation and tumor microenvironment

  • Myeloid-derived suppressor cell recruitment

Given that Hrh4 antagonists can modify macrophage infiltration and activation , they might represent a novel approach to cancer immunotherapy by reprogramming the tumor immune microenvironment.

Metabolic Diseases:
Beyond the established role in diabetic retinopathy , Hrh4 may influence:

  • Adipose tissue inflammation in obesity

  • Macrophage-mediated insulin resistance

  • Non-alcoholic steatohepatitis progression

Regenerative Medicine:
Preliminary evidence suggests Hrh4 may regulate:

  • Macrophage polarization during wound healing

  • Tissue remodeling after injury

  • Stem cell recruitment and differentiation

Potential Research Approaches:

  • Generate tissue-specific conditional Hrh4 knockout mice

  • Develop novel biased ligands that selectively modulate specific signaling pathways

  • Combine Hrh4 targeting with established therapies to enhance therapeutic outcomes

  • Explore Hrh4 as a biomarker for disease progression or treatment response

These emerging areas represent significant opportunities for researchers to expand the understanding of Hrh4 biology beyond its established roles in inflammation and allergy.

How can advanced structural biology techniques enhance our understanding of mouse Hrh4?

Advanced structural biology techniques offer unprecedented opportunities to understand mouse Hrh4 at the molecular level:

Cryo-Electron Microscopy (Cryo-EM):

  • Allows visualization of receptor-G protein complexes in different activation states

  • Can reveal subtle differences between mouse and human H4R structures

  • Enables mapping of species-specific amino acids onto 3D structures

  • Methodology: Express and purify stabilized mouse Hrh4 in complex with mini-G proteins or nanobodies

X-ray Crystallography:

  • Provides high-resolution structures for ligand binding pocket analysis

  • Requires receptor stabilization through:

    • Thermostabilizing mutations

    • Fusion partners (T4 lysozyme, BRIL)

    • Conformational stabilization with high-affinity ligands

  • Can be particularly useful for fragment-based drug discovery

Molecular Dynamics Simulations:

  • Model receptor dynamics in physiological membrane environments

  • Compare conformational equilibria between mouse and human receptors

  • Investigate the molecular basis for differences in constitutive activity

  • Predict binding modes for novel ligands

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Provides information about protein dynamics and conformational changes

  • Can identify regions with altered flexibility between species variants

  • Useful for mapping allosteric effects of ligand binding

Structure-Based Applications:

  • Drug Design:

    • Structure-guided design of species-independent antagonists

    • Development of biased ligands that selectively activate certain pathways

    • Creation of highly selective compounds with reduced off-target effects

  • Mechanism of Constitutive Activity:
    Understanding the structural basis for the different constitutive activity between mouse and human H4R could:

    • Reveal general principles of GPCR activation

    • Identify "molecular switches" that control basal activity

    • Provide insights applicable to other constitutively active GPCRs

  • Species Differences Mapping:
    Structural comparison between mouse and human H4R could:

    • Identify critical regions for species-selective pharmacology

    • Guide the design of humanized mouse models with improved predictive value

    • Enhance translational research by explaining pharmacological differences

Integrating these structural approaches with functional studies can significantly accelerate H4R-targeted drug discovery and provide fundamental insights into GPCR biology.

What novel therapeutic applications might emerge from targeting mouse Hrh4 in disease models?

Targeting mouse Hrh4 in disease models is uncovering several promising therapeutic applications beyond the established roles in allergy and pruritus:

Diabetic Complications:
The demonstrated efficacy of Hrh4 antagonism in diabetic retinopathy suggests potential in:

  • Diabetic nephropathy, where macrophage infiltration drives progression

  • Diabetic neuropathy, potentially addressing neuroinflammatory components

  • Diabetic wound healing, modulating inflammatory phenotypes to promote resolution

Autoinflammatory Disorders:
Targeting macrophage recruitment and activation via Hrh4 offers potential in:

  • Inflammatory bowel disease, particularly macrophage-driven pathologies

  • Rheumatoid arthritis, where synovial macrophages contribute to joint destruction

  • Systemic lupus erythematosus, potentially modulating aberrant immune activation

Fibrotic Diseases:
Given the role of macrophages in fibrotic processes, Hrh4 antagonists may help in:

  • Pulmonary fibrosis, reducing macrophage-driven fibrotic transformation

  • Liver fibrosis, modulating inflammatory responses that drive stellate cell activation

  • Cardiac fibrosis following myocardial infarction

Combination Therapy Approaches:
Novel therapeutic strategies may include:

DiseaseCombination ApproachRationalePotential Benefit
Diabetic retinopathyHrh4 antagonist + anti-VEGFTarget both inflammation and angiogenesis Reduced treatment frequency, enhanced efficacy
Inflammatory painHrh4 antagonist + COX inhibitorAddress both neurogenic and inflammatory componentsLower required doses, reduced side effects
AsthmaHrh4 antagonist + corticosteroidTarget complementary inflammatory pathways Steroid-sparing effect, improved symptom control

Delivery Innovations:
Novel delivery approaches for Hrh4-targeted therapeutics:

  • Nanoparticle formulations with macrophage-specific targeting

  • Extended-release implants for chronic conditions like diabetic retinopathy

  • Topical formulations for skin conditions to minimize systemic exposure

Biomarker-Guided Therapy:
Development of companion diagnostics to identify patients likely to respond:

  • Histamine levels in relevant tissues

  • Hrh4 expression profiles on circulating immune cells

  • Genetic polymorphisms affecting Hrh4 expression or function

The unique expression pattern of Hrh4, predominantly on immune cells , provides an opportunity for selective immune modulation with potentially fewer off-target effects than broader immunomodulatory approaches, making it an attractive target for these diverse therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.