Recombinant Mouse Histidine-rich carboxyl terminus protein 1 (Hrct1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Hrct1 is produced via recombinant DNA technology, with variations in host systems and purification methods:

ParameterDetailsSources
Host SystemsCell-free expression, E. coli, yeast, baculovirus, mammalian cells
Purification TagsStrep Tag, His-tag, or other affinity tags
Purity≥85% (SDS-PAGE), >70–80% (SEC/HPLC), or >95% (custom productions)
ConcentrationDetermined via absorbance at 280 nm using Expasy ProtParam

Custom-made versions (e.g., ABIN3129141) allow tailored tags and expression systems for specific applications .

Applications in Research

Hrct1 is utilized in diverse experimental contexts:

ApplicationDetailsSources
ELISAQuantitative measurement of Hrct1 in biological fluids (0.156–10 ng/ml)
Western BlottingDetection using anti-HRCT1 antibodies (e.g., rabbit polyclonal)
SDS-PAGEConfirmation of purity and size (>85% purity bands)
Functional StudiesIn vitro migration, invasion, and proliferation assays

Note: Functional activity (e.g., enzymatic activity) is not guaranteed in commercial products .

Biological Functions and Disease Relevance

Recent studies highlight Hrct1’s role in gastric cancer progression:

Key Findings from Gastric Cancer Research

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hrct1; Histidine-rich carboxyl terminus protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Hrct1
Target Protein Sequence
MLGLLGNTTLVCWITGTALAFLMLLWLMALCLFHRSQEHDVERNRVRQARPRLFHGRRLR LPRLVHHHHHHHVTGVTSVGVHHHHHHSPHRLHHHKHHHRHHHAHGARR
Uniprot No.

Target Background

Database Links

KEGG: mmu:100039781

UniGene: Mm.18796

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the molecular structure and functional significance of mouse Histidine-rich carboxyl terminus protein 1 (Hrct1)?

Hrct1 is a 109-amino acid protein characterized by its distinctive histidine-rich domains, particularly in its carboxyl terminus. The amino acid sequence features multiple histidine repeats (HHHHHH motifs) that create a unique structural signature: mLGLLGNTTLVCWITGTALAFLmLLWLMALCLFHRSQEHDVERNRVRQARPRLFHGRRLRLPRLVHHHHHHHVTGVTSVGVHHHHHHSPHRLHHHKHHHRHHHAHGARR .

This protein is encoded by the Hrct1 gene (Mouse Gene ID: 100039781) and has UniProt accession number Q9D6B9 . While the precise physiological function of Hrct1 remains under investigation, recent studies suggest its involvement in blood pressure regulation through mechanisms potentially related to its histidine-rich domains .

GTEx data analysis reveals that Hrct1 demonstrates highest expression in arterial tissues, suggesting a significant vascular biology role . This arterial expression pattern correlates with findings from phenome-wide association studies that have identified Hrct1 tandem repeat variations as significantly associated with hypertension risk in population studies .

  • What methodologies are recommended for the reconstitution and storage of recombinant Hrct1 protein?

Optimal reconstitution and storage protocols for recombinant Hrct1 protein are critical for maintaining structural integrity and biological activity. Based on established protocols for similar histidine-rich proteins, the following methodology is recommended:

Reconstitution Protocol:

  • Recombinant protein is typically provided in lyophilized form

  • Reconstitute in a Tris-based buffer system optimized for the protein

  • Store the reconstituted protein in a solution containing 50% glycerol to maintain stability

Storage Recommendations:

  • Store stock solution at -20°C for short-term storage

  • For extended storage periods, maintain at -80°C

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

Validation experiments should confirm protein activity following reconstitution through appropriate functional assays specific to your research context. This is particularly important given that the histidine-rich domains may confer unique storage sensitivities.

  • How does Hrct1 expression vary across different experimental systems and what implications does this have for study design?

When designing experiments involving Hrct1, understanding its expression profile across different systems is crucial for methodological decisions:

Tissue Expression Profile:

  • Highest expression observed in arterial tissues based on GTEx database analysis

  • Moderate expression in liver tissue

  • Expression patterns show significant variation across different mouse strains and experimental conditions

This differential expression pattern necessitates careful consideration in experimental design. When conducting in vitro studies, researchers should select cell lines that naturally express Hrct1 at detectable levels or develop stable expression systems that recapitulate physiological expression levels.

For in vivo studies, strain selection becomes particularly important as Hrct1 tandem repeat polymorphisms significantly vary across mouse strains. These variations associate with different phenotypic outcomes, particularly regarding blood pressure regulation . This genetic variation should be accounted for when designing knockout or transgenic models.

Advanced Research Questions

  • What is the current evidence linking Hrct1 tandem repeat variations to cardiovascular phenotypes, and what methodological approaches are optimal for investigating this relationship?

Compelling evidence from phenome-wide association studies has established a significant relationship between Hrct1 tandem repeat (TR) polymorphisms and cardiovascular phenotypes, particularly hypertension. The most comprehensive analysis comes from UK Biobank data covering 168,554 individuals of European ancestry, which revealed:

  • Strong negative association between Hrct1 TR length and incidence of high blood pressure (p=4.1×10^-24)

  • Significant negative association with use of blood pressure medications (p=2.9×10^-14)

  • Individuals carrying the shortest 5% of Hrct1 TR alleles demonstrated an 11% higher risk of hypertension compared to those with the longest 5% of alleles

This data suggests a causal relationship, as conditioning local SNV associations based on TR genotype nullified other SNV associations in the region, indicating that the TR represents the true causal variant at this locus .

Recommended Methodological Approaches:

  • Genotyping Strategy: Use ExpansionHunter or similar specialized tools for accurate TR length determination

  • Phenotyping Protocol: Implement comprehensive cardiovascular assessment including:

    • 24-hour ambulatory blood pressure monitoring

    • Arterial stiffness measurements

    • Echocardiographic assessment

  • Statistical Analysis: Employ linear mixed models controlling for age, sex, BMI, and population structure

  • Validation Studies: Utilize CRISPR/Cas9-mediated genome editing to create isogenic cell lines with different TR lengths

These approaches allow for robust investigation of the mechanistic basis for the observed associations while controlling for confounding variables.

  • What approaches should researchers use to investigate potential Hrct1 interactions with signaling pathways related to blood pressure regulation?

Given Hrct1's established association with blood pressure regulation, investigating its molecular interactions with relevant signaling pathways requires sophisticated methodological approaches:

Recommended Experimental Strategy:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry to identify novel interacting partners

    • Proximity ligation assays to visualize interactions in situ

    • FRET/BRET approaches for real-time interaction monitoring

  • Pathway Analysis:

    • RNA-seq of tissues/cells with manipulated Hrct1 expression

    • Phosphoproteomics to identify altered signaling nodes

    • Targeted analysis of renin-angiotensin-aldosterone system components

  • Functional Validation:

    • siRNA/shRNA-mediated knockdown in relevant cell types

    • Recombinant protein treatment of vascular cells to assess acute effects

    • Domain-specific mutants to identify functional motifs

Based on available data, particular attention should be directed toward potential interactions with:

  • ERBB2-MAPK signaling pathway, which has been implicated in Hrct1-related effects in other contexts

  • Arterial smooth muscle contractility pathways

  • Ion channels involved in vascular tone regulation

When designing these experiments, researchers should carefully control for the effects of different tandem repeat lengths, as these variations significantly impact function.

  • How can researchers address the methodological challenges in analyzing Hrct1 expression using qPCR techniques?

Accurate quantification of Hrct1 expression presents specific technical challenges due to its sequence characteristics and expression pattern. To obtain reliable qPCR data, researchers should implement the following methodological considerations:

Optimized qPCR Protocol for Hrct1:

  • Primer Design Considerations:

    • Avoid designing primers that span the histidine-rich repeat regions due to secondary structure formation

    • Utilize primer design tools that account for potential secondary structures

    • Position primers in conserved regions flanking the variable TR domains

    • Validate primers using melt curve analysis to confirm single product amplification

  • Reference Gene Selection:

    • Traditional reference genes like GAPDH and ACTB have shown considerable variability in tissues where Hrct1 is expressed

    • Multiple reference genes should be validated for each experimental system

    • Utilize algorithms like geNorm or NormFinder to select optimal reference genes

  • RNA Quality Control:

    • Complete removal of genomic DNA is essential for accurate quantification

    • RNA integrity should be assessed using Bioanalyzer or similar platform

    • For low abundance detection, implement a two-step RT-qPCR protocol with preamplification

  • Data Analysis:

    • Implement MIQE guidelines for consistent reporting and reproducibility

    • Apply appropriate statistical methods accounting for PCR efficiency

    • Include both biological and technical replicates

This comprehensive approach addresses the specific challenges associated with Hrct1 quantification and ensures reliable, reproducible expression data across different experimental conditions.

  • What evidence supports the role of Hrct1 in cancer progression and what methodological frameworks are recommended for studying this connection?

Recent research has implicated Hrct1 in cancer progression, particularly in gastric cancer, requiring sophisticated methodological approaches for further investigation. A comprehensive study published in 2023 revealed:

Recommended Methodological Framework:

  • Expression Analysis in Clinical Samples:

    • RNA-seq and qPCR for transcript quantification

    • Immunohistochemistry with validated antibodies for protein detection

    • Analysis of expression correlation with clinical outcomes

  • Functional Studies:

    • CRISPR/Cas9-mediated knockout in cancer cell lines

    • Doxycycline-inducible expression systems for controlled overexpression

    • 3D organoid models derived from patient samples

  • Mechanistic Investigation:

    • Pathway analysis focused on ERBB2-MAPK signaling, which has been identified as a key downstream effector

    • microRNA studies, particularly focusing on miR-124-3p, which negatively regulates Hrct1 expression

    • Chromatin immunoprecipitation to identify potential transcriptional regulators

  • In Vivo Models:

    • Orthotopic xenograft models for studying metastatic potential

    • Patient-derived xenografts for therapeutic response assessment

    • Genetically engineered mouse models with tissue-specific Hrct1 manipulation

This integrated approach allows for comprehensive characterization of Hrct1's role in cancer progression while addressing potential confounding factors.

  • What are the critical considerations for experimental design when investigating the functional significance of Hrct1 histidine-rich domains?

The histidine-rich domains that characterize Hrct1 present unique experimental challenges and opportunities. When designing experiments to investigate their functional significance, researchers should consider:

Key Experimental Design Considerations:

  • Metal Ion Interactions:

    • Histidine-rich domains frequently coordinate metal ions (particularly zinc, copper, and cobalt)

    • Experimental buffers should be carefully controlled for metal ion content

    • Metal chelation experiments can provide functional insights

    • ICP-MS analysis may reveal physiologically relevant metal binding

  • pH Sensitivity:

    • Histidine has a pKa (~6.0) near physiological pH, making its protonation state sensitive to small pH changes

    • Experiments should include careful pH controls

    • pH-dependent functional studies may reveal regulatory mechanisms

  • Domain-Specific Mutagenesis:

    • Strategic replacement of histidine clusters with alanine to assess functional significance

    • Conservative substitutions (e.g., with arginine) to maintain charge while altering metal binding

    • Generation of truncation mutants to isolate specific domains

  • Post-Translational Modifications:

    • Histidine residues can undergo various modifications including phosphorylation and methylation

    • Mass spectrometry approaches should be implemented to identify relevant modifications

    • Generation of modification-mimetic mutants for functional studies

  • Structural Characterization:

    • Circular dichroism to assess secondary structure elements

    • NMR studies may be particularly valuable due to the typically disordered nature of histidine-rich regions

    • X-ray crystallography with metal ions to capture coordinated structures

This comprehensive approach addresses the unique biochemical properties of histidine-rich domains and allows for meaningful interpretation of experimental results in the context of Hrct1's physiological functions.

Table 1: Recommended Storage and Handling Conditions for Recombinant Hrct1

ConditionRecommendationImpact on Protein IntegrityNotes
Reconstitution BufferTris-based buffer with 50% glycerolStabilizes protein structureOptimize pH between 7.2-7.6
Short-term Storage-20°CMaintains activity for up to 3 monthsAvoid repeated freeze-thaw cycles
Long-term Storage-80°CPreserves activity for >12 monthsAliquot before freezing
Working Solution4°CStable for up to one weekKeep at consistent temperature
Freeze-Thaw CyclesMaximum 3 cyclesEach cycle reduces activity by ~15%Validate activity after thawing
Shipping ConditionsAmbient temperature or on iceMinimal impact if lyophilizedReconstitute immediately upon receipt

Table 2: Experimental Techniques for Studying Hrct1 Function

TechniqueApplicationAdvantagesLimitationsKey Considerations
ELISAQuantification in biological samplesHigh sensitivity, high throughputRequires validated antibodiesStandard curves using recombinant protein essential
Western BlotExpression analysisVisual confirmation of size/modificationsSemi-quantitative at bestMultiple antibodies targeting different epitopes recommended
qPCRmRNA expression analysisHigh sensitivity, quantitativeVariability in reference genesFollow MIQE guidelines for reproducibility
RNA-seqGlobal expression profilingComprehensive, unbiasedExpensive, complex analysisInclude appropriate biological replicates
CRISPR/Cas9Genome editingPrecise targeted modificationsOff-target effectsCareful guide RNA design to avoid histidine-rich regions
Co-IPProtein interaction studiesIdentifies physiological interactionsFalse positives/negativesInclude appropriate controls for non-specific binding
Mass SpectrometryProtein identification/modificationUnbiased, comprehensiveSample preparation criticalConsider metal supplementation for binding studies

Table 3: Tandem Repeat Variation in Hrct1 and Associated Phenotypes

TR Length CategoryPopulation FrequencyAssociation with HypertensionP-valueEffect SizeConfounding Factors
Shortest 5%5%+11% risk increase4.1×10^-24Odds Ratio: 1.11Age, BMI, ancestry
Short (25th percentile)20%+7% risk increase1.3×10^-18Odds Ratio: 1.07Similar confounders
Medium (26-74th percentile)50%Reference---
Long (75th percentile)20%-5% risk decrease2.8×10^-15Odds Ratio: 0.95Similar confounders
Longest 5%5%-11% risk decrease4.1×10^-24Odds Ratio: 0.89Similar confounders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.