Recombinant Mouse Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (Herpud1)

Shipped with Ice Packs
In Stock

Description

Introduction

Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1) is a key component of the endoplasmic reticulum-associated degradation (ERAD) system . The accumulation of unfolded proteins in the endoplasmic reticulum (ER) initiates the ER stress response, which includes the unfolded protein response (UPR) and ERAD . HERPUD1 is involved in both UPR and ERAD . It is induced by UPR and contains an ER stress response element in its promoter region. The protein also possesses an N-terminal ubiquitin-like domain that may interact with the ERAD system .

Molecular Function and Structure

HERPUD1 is a structure-scaffolding protein in the ER membrane . It lacks known enzyme activity but regulates ERAD by interacting with proteins involved in ubiquitination and degradation during retrotranslocation . HERPUD1 interacts with Hrd1/SYVN1, an E3 ligase, ubiquitin, SEL1L, OS-9 (a lectin), and Derlin1 .

Role in ER-Associated Degradation (ERAD)

HERPUD1 is a critical component for stabilizing the ERAD multiprotein complex, directing misfolded proteins to degradation . It acts as a shuttle protein in the retrotranslocation step of ERAD . The ubiquitin-like (UBL) domain of HERPUD1 is essential for the ubiquitylation and disposal of mutant α1-antitrypsin .

Tissue Distribution

HERPUD1 is widely expressed, particularly in tissues with advanced secretory ability, such as the pancreas, suggesting its importance in these tissues .

Involvement in Disease

  • Cancer: HERPUD1 plays a role in tumorigenesis . Studies show that HERPUD1 suppression reduces the colonial growth, migration, and invasion capacity of MCF-7 breast cancer cells . HERPUD1 may regulate cell cycle phase transition proteins .

  • Cardiac Hypertrophy: HERPUD1 acts as a negative regulator of cardiac hypertrophy by modulating inositol 1,4,5-trisphosphate receptor (IP3R) degradation and $$Ca^{2+}$$ signaling . HERPUD1-knockout mice exhibit cardiac hypertrophy and dysfunction with elevated IP3R levels .

  • Macroautophagy: Stabilized HERPUD1 can downregulate macroautophagy, favoring an interplay between the ER and lysosomes, impacting drug-cell interactions . Deletion of the UBL domain in HERPUD1 leads to decreased autophagy and promotes ER remodeling into tubular structures .

Interactions

HERPUD1 interacts with UBQLN1 and UBQLN2 . It also interacts with Hrd1, enhancing the ubiquitylation and degradation of ER proteins .

Regulation of $$Ca^{2+}$$ Homeostasis

HERPUD1 controls the proteasomal degradation of the inositol 1,4,5-triphosphate receptor and ryanodine receptor proteins, which are $$Ca^{2+}$$ channels, thus playing a critical role in $$Ca^{2+}$$ homeostasis .

SILAC-Based Proteomic Study

A SILAC-based proteomic study identified HERPUD1 as a modulator of autophagy . The study monitored changes in the cellular proteome of H4 cells during starvation and shRNA-mediated knockdown of ATG5 .

Effects of UBL Domain Deletion

Deletion of the UBL domain increases HERPUD1 protein levels and causes a decrease in basal and induced autophagy . It also promotes ER remodeling, independent of the unfolded protein response activation, into stacked tubular structures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Herpud1; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPEPQPEPVTLLVKSPNQRHRDLELSGDRSWSVSRLKAHLSRVYPERPRPEDQRLIYSG KLLLDHQCLQDLLPKQEKRHVLHLVCNVKNPSKMPETSTKGAESTEQPDNSNQTQHPGDS SSDGLRQREVLRNLSPSGWENISRPEAVQQTFQGLGPGFSGYTTYGWLQLSWFQQIYARQ YYMQYLAATAASGTFVPTPSAQEIPVVSTPAPAPIHNQFPAENQPANQNAAAQAVVNPGA NQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM YLHHVGWFPFRQRPVQNFPDDGGPRDAANQDPNNNLQGGMDPEMEDPNRLPPDREVLDPE HTSPSFMSTAWLVFKTFFASLLPEGPPALAN
Uniprot No.

Target Background

Function
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 (Herpud1) is a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD). It participates in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Herpud1 interacts with ubiquilins, a critical interaction for efficient CD3D degradation via the ERAD pathway.
Gene References Into Functions
  1. Herpud1, a huntingtin-interacting protein, reduces mutant huntingtin cytotoxicity by inhibiting aggregation and promoting degradation. (PMID: 29430620)
  2. Herpud1 is essential for adequate insulin-induced glucose uptake through its role in Ca(2+)/calcineurin regulation in L6 myotubes. (PMID: 29486284)
  3. HERP significantly regulates host innate immunity during ER stress in response to RNA virus infection. (PMID: 28954889)
  4. Herpud1 may regulate cell cycle and hormone secretion in mouse granulosa cells. (PMID: 26781490)
  5. Herpud1 knockdown, achieved using lentiviral shRNA vectors, inhibited ER stress and differentially impacted inflammatory responses in RAW 264.7 macrophages exposed to tunicamycin or thapsigargin. (PMID: 26782403)
  6. Herpud1 localizes to the ERQC and recruits HRD1, targeting ERAD substrates presented by the OS-9 lectin at the ERQC. (PMID: 24478453)
  7. Herpud1 deficiency suppresses atherosclerosis in ApoE knockout mice by reducing inflammatory responses. (PMID: 24204574)
  8. Herpud1 regulates insulin secretion by controlling Nnt expression. (PMID: 23620059)
  9. Studies show embryonic lethality with Derlin-1 deficiency, normal phenotype with Derlin-3 deficiency, and glucose load and ischemia intolerance in Herpud1-deficient mice. (PMID: 22479592)
  10. Herpud1 is upregulated by Wnt-1. (PMID: 12153396)
  11. Herpud1 is a dual target (along with CHOP) regulated by both shared and ER stress-specific branches during unfolded protein response activation. (PMID: 14742429)
  12. Herpud1 is found in a complex with ubiquitinated proteins and the 26S proteasome, suggesting a role in linking substrates to the proteasome. (PMID: 18042451)
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse Herpud1 and how does it differ from human HERPUD1?

Mouse Herpud1 shares significant homology with human HERPUD1, containing the characteristic ubiquitin-like (UBL) domain that regulates its stability. The UBL domain is particularly important as deletion or modification (such as the phosphomimetic S59D mutation) can significantly alter protein stability and function . Both mouse and human proteins contain transmembrane domains that anchor them to the ER membrane and facilitate their role in ERAD processes.

What are the primary cellular functions of Herpud1?

Herpud1 functions as a scaffold protein in the ERAD pathway, playing a crucial role in the recruitment of the HRD1 ubiquitin ligase complex to misfolded proteins targeted for degradation . It interacts with multiple ERAD components including HRD1, ubiquitinated proteins, and proteasomes . Additionally, Herpud1 is involved in regulating ER morphology, calcium homeostasis, and the interplay between the ER and lysosomes . Recent evidence suggests it also negatively modulates macroautophagy, establishing it as an important regulator in the crosstalk between different protein quality control mechanisms .

How is Herpud1 expression regulated under normal and stress conditions?

Herpud1 is primarily regulated at the transcriptional level through the PERK branch of the unfolded protein response (UPR) . Under ER stress conditions, Herpud1 expression is rapidly upregulated to enhance ERAD capacity. At the protein level, Herpud1 has a short half-life due to its UBL domain, which targets it for proteasomal degradation . This tight regulation ensures that Herpud1 levels are precisely controlled to match cellular needs for protein quality control.

What are the most effective approaches for studying Herpud1 localization and dynamics in mammalian cells?

For effective visualization of Herpud1 localization and dynamics, fluorescence microscopy techniques using either antibody-based detection of endogenous Herpud1 or expression of fluorescently-tagged recombinant Herpud1 are recommended. When designing fusion proteins, C-terminal tagging is preferable as the N-terminus is involved in ER membrane insertion. For live-cell imaging, stable cell lines expressing Herpud1-GFP can be used to monitor real-time dynamics, particularly during ER stress responses.

Important considerations include:

  • Fixation protocols may affect Herpud1 localization; paraformaldehyde fixation followed by detergent permeabilization generally preserves ER structure

  • Co-labeling with ER markers (calnexin, PDI) and ERAD components (HRD1, OS-9) helps confirm authentic localization

  • Super-resolution microscopy may be required to visualize specific ERQC subcompartments where Herpud1 concentrates

What knockdown and knockout strategies are most effective for studying Herpud1 function?

Multiple approaches have proven effective for modulating Herpud1 expression:

ApproachAdvantagesLimitationsKey Considerations
siRNA/DsiRNARapid knockdown, widely accessibleTransient effect, incomplete knockdown2 nM concentration has shown effective knockdown in MCF-7 cells
shRNAStable knockdown, inducible systems availablePotential off-target effectsMultiple shRNA sequences should be tested and validated
CRISPR/Cas9Complete knockout, precise genetic modificationPotential compensation by related genesTarget early exons for complete functional disruption
Domain-specific mutationsStructure-function analysis (e.g., UBL deletion)May not represent physiological conditionsUBL deletion significantly increases protein stability

The choice depends on the specific research question, with knockdown approaches being suitable for initial characterization while CRISPR/Cas9 knockout provides more definitive evidence for gene function.

What are the recommended methods for detecting protein-protein interactions involving Herpud1?

Several complementary approaches should be employed to comprehensively map Herpud1 interaction networks:

  • Co-immunoprecipitation (co-IP): Effective for detecting relatively stable interactions between Herpud1 and partners like HRD1, OS-9, and ubiquitinated substrates . Use mild detergents (1% CHAPS or 0.5% NP-40) to preserve membrane-associated complexes.

  • Proximity labeling approaches: BioID or APEX2 fused to Herpud1 can identify transient or weak interactors in the native cellular environment.

  • Yeast two-hybrid screening: Useful for identifying direct binary interactions, although care must be taken with membrane proteins like Herpud1.

  • Fluorescence resonance energy transfer (FRET): For studying dynamics of interactions in living cells, particularly valuable for monitoring changes during ER stress.

The data from search results highlight successful co-IP approaches showing interactions between Herpud1 and HRD1, as well as the ERAD substrate and OS-9 .

How does Herpud1 coordinate ERAD substrate recruitment and processing?

Herpud1 functions as a critical organizer in ERAD by:

  • Compartmentalization: Herpud1 helps concentrate ERAD machinery and substrates in the ERQC, creating an optimized microenvironment for degradation processes .

  • Scaffold function: It interacts with multiple ERAD components simultaneously, including HRD1 ubiquitin ligase, OS-9 (a lectin involved in glycoprotein quality control), and the misfolded protein substrates .

  • Substrate processing: Herpud1 appears to stabilize the interaction between ERAD substrates and OS-9, promoting efficient substrate recognition and processing .

  • HRD1 recruitment: Herpud1 is both necessary and sufficient for the recruitment of HRD1 to the ERQC, as demonstrated by both knockdown and overexpression experiments .

The coordinated action of these mechanisms enhances ERAD efficiency, particularly during ER stress when increased Herpud1 levels lead to greater accumulation of ERAD substrates and machinery in the ERQC .

What is the relationship between Herpud1 and macroautophagy?

The relationship between Herpud1 and macroautophagy is complex and involves regulatory crosstalk:

  • Negative regulation: Stabilized Herpud1 (through UBL domain deletion) exerts negative effects on both basal and induced autophagy, as evidenced by decreased LC3-II/LC3-I ratios in HERPUD1-ΔUBL cells compared to HERPUD1-WT cells .

  • Reciprocal regulation: During starvation-induced autophagy, proteasomal degradation of pre-existing proteins supports efficient autophagy activation. Herpud1, being a proteasome substrate with a short half-life, is significantly downregulated during starvation independent of ATG5 expression .

  • ER-lysosomal network: Stabilized Herpud1 promotes ER expansion and increases lysosomal number and function, establishing an ER-lysosomal network with membrane contact sites (MCS) .

  • Stress adaptation: The Herpud1-mediated ER-lysosomal network appears to enhance cell survival under stress conditions, potentially providing an alternative adaptive mechanism when macroautophagy is compromised .

This relationship highlights Herpud1 as a critical node in the integration of different cellular quality control pathways.

How does phosphorylation affect Herpud1 function and stability?

Phosphorylation represents a key regulatory mechanism for Herpud1 function:

  • UBL domain phosphorylation: The phosphomimetic S59D mutation within the UBL domain mimics the effects of UBL deletion, increasing Herpud1 stability and promoting ER-lysosomal network expansion .

  • Functional consequences: Phosphorylation-mediated stabilization of Herpud1 leads to:

    • Decreased macroautophagy

    • Increased ER expansion and reorganization

    • Enhanced lysosomal function

    • Improved cell survival under stress conditions

  • Regulatory significance: This phosphorylation-dependent regulation suggests a potential stress-responsive mechanism whereby phosphorylation of Herpud1 at S59 could rapidly modulate its stability and function without requiring new protein synthesis.

The identification of S59 as a critical regulatory site provides a valuable target for experimental manipulation of Herpud1 function and stability.

What is known about Herpud1's role in cancer progression and therapy response?

Emerging evidence suggests complex roles for Herpud1 in cancer biology:

  • Expression patterns: Studies with patient samples have shown significantly suppressed HERPUD1 levels in cancer tissues compared to healthy tissues .

  • Functional impact in breast cancer: Experimental silencing of HERPUD1 in MCF-7 breast cancer cells resulted in:

    • Reduced expression of cell cycle-related proteins (cyclin A2, cyclin B1, cyclin E1)

    • Decreased expression of EMT-related N-cadherin and angiogenesis markers

    • Inhibition of tumorigenic features including cell proliferation, migration, invasion, and colony formation

  • Potential therapeutic relevance: These findings appear counterintuitive to the suppressed expression in tumor samples, suggesting context-dependent roles for HERPUD1 in cancer or potential adaptive mechanisms.

The apparent contradiction between clinical observations and experimental data highlights the need for further investigation into HERPUD1's role in cancer biology, considering factors such as cancer type, stage, and molecular subtype.

How does Herpud1 contribute to cellular stress responses and survival?

Herpud1 plays multifaceted roles in cellular stress adaptation:

  • UPR integration: As a UPR-inducible protein, Herpud1 helps coordinate ER stress responses by enhancing ERAD capacity to reduce misfolded protein burden .

  • ER morphology regulation: Stabilized Herpud1 triggers ER expansion by reordering the ER into crystalloid structures, potentially creating specialized environments for handling stress conditions .

  • ER-lysosomal communication: Herpud1 promotes the formation of an ER-lysosomal network with membrane contact sites, enhancing lysosomal function and potentially facilitating alternative degradation pathways when macroautophagy is compromised .

  • Stress survival: The phosphomimetic S59D mutation that stabilizes Herpud1 enhances cell survival under stress conditions, suggesting Herpud1 stability can be modulated as an adaptive mechanism .

These functions position Herpud1 as a central regulator in the integration of different stress response pathways, with implications for understanding cellular adaptation to various physiological and pathological stressors.

What evidence connects Herpud1 dysfunction to neurodegenerative disorders?

While the provided search results don't directly address Herpud1 in neurodegeneration, several aspects of its function suggest potential relevance:

  • ER stress regulation: Chronic ER stress is implicated in various neurodegenerative diseases. As a key UPR effector and ERAD component, Herpud1 dysfunction could potentially contribute to pathogenesis.

  • Protein quality control: Given its role in ERAD and negative regulation of autophagy , Herpud1 dysfunction could impact the clearance of aggregation-prone proteins characteristic of many neurodegenerative disorders.

  • Calcium homeostasis: The search results mention Herpud1's involvement in controlling Ca2+ homeostasis via regulation of calcium channels , a process critical for neuronal function and implicated in neurodegeneration.

  • ER-lysosomal communication: The Herpud1-mediated ER-lysosomal network may be relevant to neurodegenerative diseases where lysosomal dysfunction is prominent.

Research directly examining Herpud1 in neurodegenerative contexts would be valuable to substantiate these potential connections and determine whether Herpud1 modulation could represent a therapeutic approach.

What expression systems are optimal for producing functional recombinant mouse Herpud1?

The choice of expression system for recombinant mouse Herpud1 depends on experimental requirements:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effectiveLacks mammalian PTMs, challenging for membrane proteinsDomain-specific studies (e.g., isolated UBL domain)
Insect cells (Sf9, Sf21)Higher eukaryotic PTMs, better for membrane proteinsModerate yield, more complex than bacteriaFull-length protein for structural studies
Mammalian cells (HEK293, CHO)Native-like PTMs, proper foldingLower yield, expensiveFunctional studies requiring authentic protein regulation

For most functional studies examining Herpud1's role in ERAD and autophagy regulation, mammalian expression systems are preferable to ensure proper membrane insertion, post-translational modifications, and protein-protein interactions.

What purification strategies yield the highest quality recombinant Herpud1?

Purification of Herpud1 presents challenges due to its membrane association and tendency to form complexes. A successful purification strategy might include:

  • Solubilization: Use mild detergents (DDM, CHAPS, or digitonin) to extract Herpud1 while preserving its native conformation.

  • Affinity chromatography: Employ epitope tags (His6, FLAG, or Strep) positioned to minimize interference with function. C-terminal tagging is generally preferable.

  • Size exclusion chromatography: Useful for separating monomeric protein from aggregates or oligomeric complexes.

  • Quality control: Assess purified protein by:

    • SDS-PAGE for purity

    • Western blot for identity confirmation

    • Circular dichroism for secondary structure verification

    • Functional assays (e.g., binding to known partners like HRD1)

For structural biology applications, consider nanodiscs or amphipols as alternatives to detergents for maintaining Herpud1 in a membrane-like environment.

What are the critical factors for designing functional domain mutants of Herpud1?

When designing Herpud1 domain mutants for functional studies, consider these key factors:

  • UBL domain modifications:

    • Complete UBL deletion (ΔUBL) significantly increases protein stability and alters ER morphology

    • The S59D phosphomimetic mutation within the UBL domain mimics UBL deletion effects

    • Consider alanine substitution (S59A) as a non-phosphorylatable control

  • Transmembrane domains:

    • Maintain the integrity of transmembrane regions to preserve ER localization

    • Consider domain swapping with other ER membrane proteins to assess specificity

  • Interaction domains:

    • Target regions involved in specific protein-protein interactions (e.g., with HRD1 or OS-9)

    • Use available structural information or prediction tools to design precise mutations that disrupt specific interactions

  • Controls and validation:

    • Include wild-type controls in all experiments

    • Verify proper expression and localization of mutant proteins

    • Assess stability using cycloheximide chase experiments, particularly for UBL domain mutants

The UBL domain has proven particularly informative for understanding Herpud1 regulation and function, as demonstrated by the significant phenotypes observed with UBL deletion and S59D mutation .

How can conflicting data on Herpud1 function in different experimental systems be reconciled?

When facing contradictory results across experimental systems, consider these approaches to reconciliation:

  • Context-dependent regulation:

    • Cell type specificity: Herpud1 may function differently in different cell types based on expression levels of interacting partners

    • Stress conditions: The function of Herpud1 may vary between basal and stress conditions

    • Example: The apparently contradictory roles of Herpud1 in breast cancer (suppressed in tumors but supporting tumorigenic features in cell culture) may reflect such context dependence

  • Methodological considerations:

    • Acute vs. chronic modulation: Transient knockdown vs. stable knockout may reveal different aspects of function

    • Expression levels: Overexpression studies may not reflect physiological regulation

    • Protein modifications: Post-translational modifications like phosphorylation at S59 can dramatically alter function

  • Systematic validation:

    • Employ multiple complementary approaches (genetic, biochemical, imaging)

    • Verify findings across different cell types and experimental conditions

    • When possible, validate in vivo to establish physiological relevance

  • Mechanistic resolution:

    • Determine whether seemingly contradictory functions reflect different molecular mechanisms

    • Example: The negative regulation of macroautophagy by Herpud1 occurs alongside promotion of an ER-lysosomal network , suggesting coordinated regulation of alternative pathways

What are common challenges in Herpud1 detection and quantification?

Researchers commonly encounter these challenges when working with Herpud1:

  • Protein stability issues:

    • Native Herpud1 has a short half-life due to proteasomal degradation

    • Use proteasome inhibitors (MG132) when assessing endogenous levels

    • Consider the S59D phosphomimetic mutant for studies requiring stable expression

  • Antibody specificity:

    • Commercial antibodies vary in specificity; validate using knockout/knockdown controls

    • The recommended dilution for rabbit polyclonal HERP1 antibody (10813-1-AP) is 1:3500 for reliable detection

  • Subcellular localization:

    • Herpud1 concentrates in specific ER subdomains (ERQC)

    • Standard fixation may not preserve these structures; optimize fixation protocols

    • Co-staining with ER markers helps confirm authentic localization

  • Expression level variability:

    • Herpud1 is highly inducible by ER stress

    • Standardize culture conditions to minimize variability

    • Include positive controls (e.g., tunicamycin treatment) to verify antibody performance

  • Quantification approaches:

    • For Western blots, normalize to stable housekeeping proteins

    • For microscopy, use consistent imaging parameters and quantify multiple cells across independent experiments

How should researchers design experiments to distinguish between Herpud1's roles in ERAD and autophagy?

To dissect Herpud1's distinct functions in ERAD and autophagy:

  • Sequential inhibition approach:

    • Use specific inhibitors of each pathway individually and in combination

    • ERAD inhibition: MG132 (proteasome), Eeyarestatin I (p97/VCP)

    • Autophagy inhibition: Bafilomycin A1 (lysosomal acidification), 3-MA (early autophagy)

    • Monitor substrate accumulation patterns under different inhibition conditions

  • Substrate specificity analysis:

    • Compare effects on model substrates specific to each pathway:

      • ERAD: Null Hong Kong α1-antitrypsin, CD3δ

      • Autophagy: aggregate-prone proteins like mutant huntingtin

    • Assess whether Herpud1 manipulation differentially affects these substrates

  • Mechanistic separation:

    • Use domain-specific mutations (e.g., ΔUBL, S59D) that have been shown to affect autophagy

    • Create interaction-deficient mutants that selectively disrupt binding to components of one pathway but not the other

  • Temporal analysis:

    • Perform time-course experiments following Herpud1 induction or depletion

    • Determine whether effects on ERAD and autophagy occur simultaneously or sequentially

  • Stress-specific responses:

    • Compare ER stress (tunicamycin, thapsigargin) vs. starvation stress (EBSS medium)

    • LC3-II/LC3-I ratio in the presence of Bafilomycin A1 can assess autophagic flux under different conditions

These approaches can help resolve the complex interplay between Herpud1's roles in different protein quality control mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.