Recombinant Mouse Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2)

Shipped with Ice Packs
In Stock

Description

Introduction

Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2), also known as HERP2, is a protein involved in endoplasmic reticulum-associated degradation (ERAD) . ERAD is a process where misfolded proteins in the endoplasmic reticulum (ER) are retrotranslocated to the cytosol and degraded by the proteasome . HERPUD2 is similar to HERP1, having a ubiquitin-like (UBL) domain at the N terminus and a hydrophobic segment near the C-terminal region .

Role in ERAD

HERP1 and HERP2 are essential adaptors between HRD1 and DERL2, which helps in organizing a functional retrotranslocation complex in HRD1-mediated ERAD . HERP proteins are required for the degradation of HRD1 substrates . HERP facilitates the recruitment of HRD1 and misfolded proteins to the ER-derived quality control compartment (ERQC), which is essential for ERAD .

HERP1 and HERP2 Functionality

HERP1 has been implicated in ERAD, though the mechanism was unknown . HERP1 and HERP2 are integral components of the HRD1 complex, facilitating retrotranslocation by recruiting DERL2 to HRD1 . HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress . HERP1 and HERP2 are partially redundant and required for HRD1-mediated retrotranslocation .

HERPUD2 Interactions

HERP1 and HERP2 are part of the HRD1-SEL1L-DERL2 complex . HERPUD2 may interact with other proteins involved in ERAD and UPR, though further research is needed to fully elucidate these interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Herpud2; MNCb-2040; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Herpud2
Target Protein Sequence
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG RLLPDHLQLKDILRKQDEYHMVHLVCASRSPPSSPKSSTDRGSHEALASSTSSNSDHSDS TTPSPSQESLSLVTGSSEGLRQRTLSQAQTDPAQSHQFPYVIQGNVDHQFPGQGVPPAFP VYPALSPLQMLWWQQMYAHQYYMQYQAAVSAQATSSAGSAQRAASSPLNLAHVPGEEPPP APNLVAQENGPMNENVQMNAQGGPVLNEEDLNRDWLDWVYTFSRAAVLLSIVYFYSSFSR FIMVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANNDGHNANNLELEEMERLMDDGLE DESGEDAGEDASAAQRPGLMASAWSFITTFFTSLIPEGPPQVAN
Uniprot No.

Target Background

Function
Potentially involved in the unfolded protein response (UPR) pathway.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic molecular structure of Herpud2?

Herpud2 (Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2) is characterized by a ubiquitin-like (UBL) domain at its N-terminus and a long hydrophobic segment positioned near the C-terminal region. This structural arrangement enables its specific interactions with other components of the endoplasmic reticulum quality control machinery. The protein shares approximately 38% sequence identity and 51% homology with its paralog Herpud1, suggesting evolutionary conservation of critical functional domains while allowing for differentiated roles within the cell .

How does Herpud2 differ from Herpud1 in expression patterns?

Unlike Herpud1, which is highly inducible under ER stress conditions, Herpud2 demonstrates constitutive expression patterns in mammalian cells. This fundamental difference suggests that while Herpud1 serves primarily as an adaptive response protein during cellular stress, Herpud2 maintains basal functions in protein quality control mechanisms under normal physiological conditions. The differential regulation allows cells to maintain homeostatic ERAD functions while having the capacity to upregulate additional components during stress responses .

What is the subcellular localization of Herpud2?

Immunofluorescence studies using confocal microscopy have demonstrated that Herpud2 displays a predominantly perinuclear localization pattern that overlaps with ER markers such as Sec61α. Cell fractionation experiments confirm that Herpud2 is exclusively present in membrane fractions rather than cytosolic compartments, confirming its identity as an integral membrane protein of the endoplasmic reticulum. This localization is critical for its functional role in organizing retrotranslocation complexes at the ER membrane .

What are the recommended approaches for detecting endogenous Herpud2?

For detection of endogenous Herpud2, immunoblotting with validated antibodies specific to Herpud2 (that do not cross-react with Herpud1) is the preferred method. Researchers can employ cell fractionation followed by membrane protein extraction and subsequent western blotting. For subcellular localization studies, immunofluorescence using anti-Herpud2 antibodies and DyLight488-conjugated secondary antibodies provides excellent results when analyzed via confocal microscopy. When designing experiments, it is essential to verify antibody specificity since the homology between Herpud1 and Herpud2 can lead to cross-reactivity issues .

How can researchers establish stable cell lines expressing Herpud2?

To generate stable cell lines expressing tagged Herpud2, researchers should consider the following methodology: transfect the plasmid encoding Herpud2 (with appropriate epitope tags) into target cells using a transfection reagent such as TransIT-LT1. For optimal selection, incorporate the construct into a vector system that includes a selection marker (e.g., pIRES-EGFP vector allowing for flow cytometry-based selection). Following transfection, conduct selection by flow cytometry or antibiotic resistance, and confirm expression through western blot analysis using both tag-specific and Herpud2-specific antibodies. This approach has been successfully implemented with related proteins such as HRD1-Myc in 293T cells .

What experimental systems are most appropriate for studying Herpud2 function?

Human 293T cells and U2OS cells have been successfully used to study Herpud2 function, particularly in the context of ERAD pathways. These cell lines can be maintained in DMEM or McCoy's 5A medium supplemented with 10% fetal bovine serum and antibiotics. For functional studies, siRNA-mediated knockdown approaches have proven effective, with simultaneous depletion of both Herpud1 and Herpud2 often necessary to observe significant phenotypes due to their partially redundant functions. Cycloheximide chase experiments combined with western blotting provide a robust method for measuring protein degradation rates when studying Herpud2's role in ERAD .

How does Herpud2 contribute to ER-associated degradation (ERAD)?

Herpud2 functions as an essential adaptor protein within the HRD1 complex, facilitating the retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation. Specifically, Herpud2 recruits DERL2 (Derlin-2) to the E3 ubiquitin ligase HRD1, thereby organizing a functional retrotranslocation complex. This adaptor function is critical for the degradation of both glycosylated and non-glycosylated ERAD substrates, including SHH (sonic hedgehog) variants and NHK (null Hong Kong α1-antitrypsin). Experimental evidence demonstrates that simultaneous depletion of both Herpud1 and Herpud2 results in significant stabilization of these ERAD substrates, confirming their functional importance in this pathway .

How can researchers differentiate between Herpud1 and Herpud2 functions experimentally?

To differentiate between Herpud1 and Herpud2 functions, researchers should employ the following approaches:

  • Use specific siRNAs targeting each protein individually and in combination, followed by cycloheximide chase experiments to measure degradation rates of known ERAD substrates

  • Analyze protein expression under various stress conditions, as Herpud1 is highly stress-inducible while Herpud2 maintains constitutive expression

  • Perform co-immunoprecipitation studies to identify unique binding partners for each protein

  • Conduct complementation experiments by expressing siRNA-resistant versions of either protein in double-knockdown cells to assess rescue effects

These approaches allow for detailed dissection of their potentially unique roles while accounting for their overlapping functions .

How do Herpud2 inhibitors modulate ER stress pathways?

Herpud2 inhibitors represent an emerging class of chemical tools designed to selectively bind to and modulate the activity of Herpud2 protein. These inhibitors target specific binding sites on Herpud2, disrupting its interactions with other proteins involved in ER stress pathways, particularly its recruitment of DERL2 to the HRD1 complex. By interfering with this adaptor function, these inhibitors can disrupt the assembly of functional retrotranslocation complexes, thereby affecting ERAD efficiency. Researchers can utilize these inhibitors to:

  • Investigate the temporal dynamics of ERAD complex assembly

  • Assess the consequences of acute vs. chronic disruption of Herpud2 function

  • Determine substrate-specific effects of Herpud2 inhibition

  • Explore potential therapeutic applications in diseases associated with dysregulated ERAD

What are the recommended experimental approaches for studying Herpud2's role in protein quality control?

To comprehensively study Herpud2's role in protein quality control mechanisms, researchers should implement a multi-faceted approach:

  • Substrate degradation kinetics: Utilize cycloheximide chase experiments with model ERAD substrates (SHH-C, SHH-N278A, NHK) in cells with manipulated Herpud2 levels

  • Complex composition analysis: Perform blue native PAGE or co-immunoprecipitation studies to assess how Herpud2 manipulation affects the composition of HRD1 complexes

  • Ubiquitination assays: Measure substrate ubiquitination levels to determine if Herpud2 affects the recognition or ubiquitination efficiency of ERAD substrates

  • ER stress markers: Monitor changes in canonical ER stress markers (BiP, CHOP, XBP1 splicing) when Herpud2 function is compromised

  • Live-cell imaging: Employ fluorescently tagged ERAD components to visualize complex dynamics in real-time

This comprehensive approach allows researchers to gain mechanistic insights into Herpud2's specific contributions to protein quality control .

How might Herpud2 function differently across various tissues or developmental stages?

While current research has primarily focused on Herpud2 function in established cell lines, there remains significant potential for tissue-specific and developmental variations in its activity. Based on known principles of ERAD regulation, researchers should consider:

  • Analyzing Herpud2 expression levels across different mouse tissues using qRT-PCR and western blotting

  • Comparing Herpud2's interactome in tissue-specific primary cells using mass spectrometry-based approaches

  • Investigating potential post-translational modifications of Herpud2 that might occur in a tissue-specific manner

  • Examining Herpud2 expression and function during embryonic development, particularly in tissues with high secretory capacity

  • Utilizing conditional knockout mouse models to assess tissue-specific phenotypes resulting from Herpud2 deficiency

These approaches would provide valuable insights into potential specialized functions of Herpud2 beyond the currently established cellular models .

What challenges might researchers encounter when studying Herpud2, and how can they be addressed?

Several technical challenges commonly arise when studying Herpud2:

  • Antibody specificity issues: Due to the homology between Herpud1 and Herpud2, antibody cross-reactivity can occur. Solution: Validate antibodies using knockdown cells and recombinant proteins as controls; consider using epitope-tagged versions for clear detection.

  • Functional redundancy masking phenotypes: Individual knockdown of Herpud2 often produces minimal effects due to compensation by Herpud1. Solution: Perform simultaneous knockdown of both proteins; use graded knockdown approaches to identify potential threshold effects.

  • Substrate specificity determination: Identifying specific ERAD substrates preferentially processed by Herpud2 vs. Herpud1. Solution: Conduct comparative proteomics on cells with selective knockdown of each protein; utilize in vitro reconstitution systems with purified components.

  • ER stress confounding variables: Knockdown approaches may induce ER stress, complicating interpretation. Solution: Include appropriate controls measuring canonical ER stress markers; use acute inhibition approaches where possible .

How should contradictory results regarding Herpud2 function be interpreted?

When encountering contradictory results in Herpud2 research, consider these analytical approaches:

  • Cell type differences: Variation in the expression levels of other ERAD components across cell types may affect the relative importance of Herpud2. Compare the expression profiles of key ERAD components across the experimental systems.

  • Substrate-specific effects: Different ERAD substrates may rely on Herpud2 to varying degrees. Systematically test multiple well-characterized ERAD substrates in parallel experiments.

  • Knockdown efficiency variation: Incomplete knockdown may lead to residual function. Quantify knockdown efficiency at both mRNA and protein levels, and consider using CRISPR-based approaches for complete elimination.

  • Stress conditions: The cellular stress state can dramatically affect ERAD dynamics. Carefully control and document growth conditions, passage number, and confluence levels across experiments.

  • Experimental timescales: Acute vs. chronic depletion may yield different results due to compensatory mechanisms. Consider using inducible knockdown or acute inhibition approaches .

What are promising areas for advanced Herpud2 research?

Several emerging research directions hold particular promise for advancing our understanding of Herpud2:

  • Structural biology approaches: Determining the three-dimensional structure of Herpud2, particularly in complex with HRD1 and DERL2, would provide critical insights into its adaptor function and potential druggable sites.

  • Systems biology integration: Comprehensive -omics analyses of cells with manipulated Herpud2 levels under various stress conditions could reveal broader impacts on cellular homeostasis beyond the currently established ERAD functions.

  • In vivo mouse models: Development of conditional and tissue-specific Herpud2 knockout mouse models would allow for investigation of its physiological roles and potential connections to disease states.

  • Therapeutic targeting: Exploration of selective Herpud2 modulators as potential therapeutics for diseases characterized by protein misfolding or dysregulated ER stress responses.

  • Evolutionary conservation analysis: Comparative studies of Herpud2 function across species could reveal evolutionarily conserved mechanisms and species-specific adaptations in ERAD pathways .

How might advanced technologies enhance Herpud2 research?

Emerging technologies that could significantly advance Herpud2 research include:

  • Cryo-electron microscopy: For visualizing the native structure of Herpud2 within the HRD1 complex

  • Proximity labeling approaches: BioID or APEX2-based methods to comprehensively map the Herpud2 interactome under various conditions

  • Single-cell analysis: Examining cell-to-cell variation in Herpud2 expression and function within tissues

  • Organoid models: Investigating Herpud2 function in more physiologically relevant three-dimensional tissue models

  • CRISPR-based screening: Identifying genetic interactions and pathways that buffer or enhance Herpud2 function

These approaches would provide unprecedented insights into Herpud2 biology and potentially reveal novel therapeutic targets .

How does mouse Herpud2 compare with human HERPUD2?

The mouse Herpud2 and human HERPUD2 proteins share high sequence conservation, particularly in functional domains such as the ubiquitin-like domain and the C-terminal hydrophobic region. This conservation suggests evolutionary preservation of critical functions in ERAD pathways. When designing experiments using recombinant mouse Herpud2 as a model for human biology, researchers should consider:

  • Domain-specific sequence conservation analysis

  • Comparative interaction studies with known binding partners

  • Cross-species complementation experiments to test functional equivalence

  • Species-specific post-translational modifications that might affect function

Understanding these similarities and differences is essential for translating findings from mouse models to human applications .

What experimental systems best represent physiological Herpud2 function?

While cell line models provide valuable mechanistic insights, researchers should consider these approaches for more physiologically relevant studies:

Experimental SystemAdvantagesLimitationsBest Applications
Primary mouse hepatocytesPhysiological expression levels, intact ERAD machineryLimited lifespan, variable isolation qualityAcute studies of native Herpud2 function
Mouse embryonic fibroblastsGenetically tractable, can be immortalizedAdaptation during culture may alter ERADGenetic interaction studies
Tissue-specific organoids3D organization, cell-type heterogeneityTechnical complexity, costTissue-specific functions
In vivo mouse modelsComplete physiological contextComplex phenotype interpretationDisease relevance studies
Human iPSC-derived cellsHuman-specific biologyVariability between linesTranslational research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.