Recombinant Mouse Hyaluronan synthase 1 (Has1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

Has1 is a membrane-bound, multi-pass transmembrane protein encoded by the Has1 gene (UniProt ID: Q61647) in mice. It belongs to the NodC/HAS family and catalyzes the alternating addition of β-1,3-N-acetylglucosamine (GlcNAc) and β-1,4-glucuronic acid (GlcUA) to form HA chains . Unlike HAS2 and HAS3, Has1 exhibits substrate-dependent versatility, synthesizing chito-oligosaccharides when incubated with UDP-GlcNAc alone .

Key Functional Features:

  • Enzymatic Activity: Requires UDP-GlcNAc and UDP-GlcUA for HA synthesis, with lower substrate affinity compared to HAS2 and HAS3 .

  • Chito-Oligosaccharide Synthesis: Produces chitin-like polymers under low UDP-GlcUA conditions .

  • Post-Translational Regulation: Activity is influenced by disulfide bond formation and substrate availability (e.g., glucosamine enhances HA production) .

Recombinant Expression Systems

Recombinant mouse Has1 is produced in multiple heterologous systems to meet research needs:

Table 1: Recombinant Mouse Has1 Variants

Product IDHost SystemTagProtein LengthSource
RFL19950MFE. coliHisFull-length (1-583 aa)Creative BioMart
Has1-7852RE. coliHisTyr164–Ala421Creative BioMart
Has1-426RS. cerevisiaeHisMet1–Val583Creative BioMart

These variants enable studies on enzyme kinetics, HA polymer length regulation, and structural analysis.

Biochemical and Kinetic Properties

Recombinant Has1 exhibits distinct biochemical traits:

  • Molecular Weight: ~65.5 kDa (predicted) .

  • Detection Sensitivity: 0.156 ng/mL (ELISA) .

  • Substrate Kinetics:

    • Higher K<sub>m</sub> values for UDP-GlcNAc and UDP-GlcUA than HAS2, requiring elevated substrate concentrations for optimal activity .

    • Activity is enhanced under reconstitutive conditions with detergents like CHAPS .

4.1. Disease Mechanisms

  • Fibrosis and Inflammation: Has1 defines fibroblast subpopulations linked to kidney recovery post-ischemia, suggesting a protective role against fibrosis .

  • Cancer: Overexpression correlates with tumor aggressiveness and stromal HA accumulation in breast carcinoma .

4.2. Analytical Tools

  • Mouse Has1 ELISA Kit: Quantifies Has1 in serum, plasma, and cell cultures (Detection range: 0.312–20 ng/mL) .

  • Immunofluorescence: Localizes Has1 in membrane protrusions and perinuclear regions .

Challenges and Future Directions

While recombinant Has1 facilitates HA-related research, its low basal activity in standard conditions necessitates substrate supplementation . Future studies may explore:

  • Isoform-specific inhibitors for therapeutic targeting.

  • Structural resolution of Has1 to elucidate HA chain length regulation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your request when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Has1; Has; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Has1
Target Protein Sequence
MRQDMPKPSEAARCCSGLARRALTIIFALLILGLMTWAYAAGVPLASDRYGLLAFGLYGA FLSAHLVAQSLFAYLEHRRVAAAARRSLAKGPLDAATARSVALTISAYQEDPAYLRQCLT SARALLYPHTRLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAEAT GAVGEGAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQV CDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERAC QSYFHCVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKY TSRSRCYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFV AATVLRLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCVRMVLLSLYAPLYMCGLLPA KFLALVTMNQSGWGTSGRKKLAANYVPVLPLALWALLLLGGLARSVAQEARADWSGPSRA AEAYHLAAGAGAYVAYWVVMLTIYWVGVRRLCRRRSGGYRVQV
Uniprot No.

Target Background

Function
Hyaluronan synthase 1 (Has1) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Consequently, it is crucial for hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan plays a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. Has1 is one of the isozymes responsible for this reaction. It can also catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Gene References Into Functions
  1. A study examining expression patterns of Has1, -2, -3 mRNA in developing mouse molar and incisor tooth germs from embryonic day (E) 11.5 to postnatal day (P) 7, focused on Hertwig's epithelial root sheath (HERS) and the apical bud. Has1 mRNA expression was not detected in any of the tooth germs examined. PMID: 27289075
  2. HAS1 was significantly upregulated at the gene expression level during muscle hypertrophy. PMID: 22785117
  3. An analysis of changes in cervical glycosaminoglycan composition during normal pregnancy and preterm birth revealed that Has1 is expressed in preterm birth, while Has2 is induced at term. PMID: 22529214
  4. Selective loss of Has1 and Has3 leads to a proinflammatory environment that favors recruitment of neutrophils and other inflammation-related changes in the dermis. PMID: 21850020
  5. Repression of HA accumulation by both COX-2 selective and non-selective COX inhibition implicates COX-2 in the regulation of HA synthesis through stimulation of HAS1 and HAS2 expression in vivo. PMID: 19320776
  6. Proper regulation of the expression of each HAS isoform is required for optimal malignant transformation and tumor growth. PMID: 14724275
  7. Has1 is expressed throughout the gastrulating embryo. PMID: 15765504
  8. ASMCs transduced with Has-1 accumulated the greatest amount of HA-containing ECM compared to other transduced ASMCs. Confocal microscopy showed CD44 positive monocytes bound to hyaluronidase-sensitive ECM in has-1 transduced ASMCs. PMID: 16110480

Show More

Hide All

Database Links
Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Hyaluronan Synthase 1 (Has1) and how does it differ functionally from other Has isoforms?

Mouse Has1 is one of three isoenzymes (Has1, Has2, and Has3) responsible for cellular hyaluronan synthesis. Unlike Has2, which is essential for embryonic development, Has1 shows distinct enzymatic properties and expression patterns. The most significant functional difference lies in Has1's substrate affinities - it has a lower affinity for UDP-glucuronic acid (UDP-GlcUA) compared to Has2 and Has3, with its Km value approximately double that of the other isoforms . Similarly, Has1's affinity for UDP-N-acetylglucosamine (UDP-GlcNAc) is two to three times lower than Has2 and Has3 . These differences in substrate requirements suggest Has1 may function as a more selective hyaluronan producer, potentially activated only under specific cellular conditions when substrate concentrations are sufficiently high.

What is the subcellular localization pattern of Has1 in mouse cells?

Has1 displays a distinctive subcellular localization pattern that differs from Has2 and Has3. Immunostaining of endogenous Has1 shows notable expression in mesothelial cells, fibroblasts, and mouse embryonic fibroblasts (MEFs) . Has1 demonstrates a reticular localization pattern suggesting association with cytoskeletal structures or the endoplasmic reticulum - a distribution not typical for Has2 or Has3 . This unique localization pattern indicates Has1 likely has different regulatory mechanisms and binding partners compared to other Has isoforms. In transfection studies, HAS1 fusion proteins localize with microtubules and other cytoskeletal structures, further supporting Has1's association with the cellular architecture .

What expression systems are most effective for producing recombinant Mouse Has1?

Several expression systems have demonstrated success for recombinant Has1 production, each with specific advantages for different research applications. Bacterial systems using Escherichia coli can produce Has1 protein fragments (specific amino acid regions) with high purity (>95%) suitable for structural studies, antibody production, and preliminary biochemical assays . For full-length Has1 that requires proper folding and post-translational modifications, mammalian expression systems using HEK-293 cells yield more functionally relevant protein with >90% purity as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC . Cell-free protein synthesis systems represent an alternative approach for Has1 production, typically achieving 70-80% purity while avoiding complications associated with membrane protein expression in cellular systems . The optimal system depends on the experimental requirements - bacterial systems for high-yield applications not requiring full enzymatic activity, and mammalian systems for functional studies.

How can researchers optimize activity measurements for recombinant Mouse Has1?

Optimizing activity measurements for recombinant Mouse Has1 requires careful consideration of its unique substrate requirements. Due to Has1's lower affinity for UDP-GlcUA and UDP-GlcNAc compared to other Has isoforms, activity assays must include sufficiently high substrate concentrations to reach saturation . The availability of UDP-GlcNAc significantly affects Has1 activity in a dose-dependent manner, but interestingly does not considerably influence Has1's Km toward UDP-GlcUA . Researchers should design experiments with UDP-GlcNAc concentrations at least 3-5× the Km value to ensure saturation of the enzyme. Additionally, Has1 requires divalent cations (Mg²⁺ or Mn²⁺) for activity, so buffer compositions must be optimized accordingly . When using cell-based systems, treatments with glucose or glucosamine can enhance Has1 activity by increasing intracellular substrate availability . Researchers should also note that even with Has1 overexpression, some cell lines (like COS-1 and MCF-7) show negligible hyaluronan production without substrate supplementation .

What purification strategies yield functional recombinant Has1 protein?

Purification of functional recombinant Has1 presents challenges due to its multiple transmembrane domains (4-6) and membrane-associated regions (1-2) . For research requiring functional protein, affinity-tag based approaches using His-tag or Strep-tag constructs have proven successful . When purifying from mammalian systems like HEK-293 cells, proper solubilization using mild detergents that preserve protein structure is critical. Analytical methods including Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) should be employed to assess purity (target >90% for functional studies) . For bacterial expression systems, inclusion body recovery followed by refolding protocols may be necessary, though these approaches typically yield lower enzymatic activity. When working with mouse Has1, researchers should verify functionality through activity assays measuring hyaluronan production rather than assuming activity based solely on protein purity.

What critical factors should researchers consider when designing mouse models to study Has1 function?

When designing mouse models to study Has1 function, researchers must account for several critical factors that influence experimental reproducibility and data interpretation. First, remember that inbred mice, despite being genetically identical within a strain, can show phenotypic variability and are sensitive to environmental factors . This inherent biological variability necessitates proper controls and sufficient sample sizes. Second, since Has1 knockout mice are phenotypically normal under standard conditions , researchers should design experiments that challenge the system - such as wound healing models, inflammation induction, or carcinogenesis studies where Has1's role may become apparent. Third, the potential compensation by Has2 and Has3 must be addressed, potentially through tissue-specific or inducible knockout strategies. Finally, researchers should carefully select mouse strains as they vary considerably in their biological responses, similar to dog breeds . The experimental design should align with the 3Rs principles (Replacement, Refinement, Reduction) while ensuring adequate statistical power .

How should experiments be designed to account for Has1's unique substrate affinities?

Designing experiments to account for Has1's unique substrate affinities requires careful consideration of substrate availability and enzymatic kinetics. Has1 has approximately half the affinity for UDP-GlcUA compared to Has2 and Has3, and its affinity for UDP-GlcNAc is 2-3 times lower than other Has isoforms . Therefore, in vitro enzymatic assays should include substrate concentration ranges that extend well above the Km values to ensure saturation. For cellular experiments, researchers should consider supplementing culture media with glucose or glucosamine to increase intracellular substrate pools, as Has1 activity is highly dependent on substrate availability . Additionally, experiments should account for the observation that Has1 activity is dose-dependently affected by substrate availability . When comparing Has1 with other Has isoforms, researchers must normalize activity measurements to account for these differences in substrate affinity to avoid misinterpreting results. Finally, the influence of divalent cations (Mg²⁺ or Mn²⁺) on Has1 activity should be standardized across experimental conditions .

What controls are essential when studying Has1 in mouse embryonic fibroblasts?

When studying Has1 in mouse embryonic fibroblasts (MEFs), several controls are essential to ensure valid and reproducible results. First, since Has1 was identified as the most upregulated gene in aneuploid MEFs with malignant properties , researchers must verify cellular karyotype stability to distinguish Has1 regulation from effects of aneuploidy. Second, passage-matched control cells are critical as MEFs undergo phenotypic changes with increasing passages. Third, researchers should quantify the expression levels of all three Has isoforms (Has1, Has2, Has3) to account for potential compensatory mechanisms. Fourth, since Has1 demonstrates reticular localization patterns associated with cytoskeletal structures or endoplasmic reticulum , appropriate subcellular markers should be included in localization studies. Fifth, when assessing Has1 activity, substrate availability should be controlled through standardized media composition or supplementation. Finally, researchers should include both gain-of-function (Has1 overexpression) and loss-of-function (Has1 knockdown/knockout) approaches to comprehensively characterize Has1's role in MEFs.

What approaches are recommended for studying the interaction between Has1 and the cytoskeleton?

Given Has1's unique reticular localization pattern suggesting association with cytoskeletal structures , several approaches are recommended for studying this interaction. First, high-resolution confocal microscopy using validated antibodies against endogenous Has1 combined with markers for different cytoskeletal components (actin filaments, microtubules, intermediate filaments) can reveal spatial relationships. Second, proximity ligation assays (PLA) can detect direct interactions between Has1 and specific cytoskeletal proteins with nanometer resolution. Third, immunoprecipitation followed by mass spectrometry can identify cytoskeletal binding partners of Has1. Fourth, live-cell imaging with fluorescently tagged Has1 can reveal dynamic interactions with the cytoskeleton during processes like cell division or migration. Fifth, cytoskeleton-disrupting agents (e.g., nocodazole for microtubules, cytochalasin D for actin) can determine which cytoskeletal components are critical for Has1 localization and function. Finally, domain mapping using truncated or mutated Has1 constructs can identify specific regions responsible for cytoskeletal interactions. These approaches should be conducted with appropriate controls, including Has2 and Has3, to determine whether cytoskeletal association is unique to Has1 or common among hyaluronan synthases.

How can researchers differentiate between Has1, Has2, and Has3 activities in complex biological samples?

Differentiating between the activities of Has1, Has2, and Has3 in complex biological samples presents significant challenges due to their functional overlap, but several strategies can help researchers address this question. First, exploit the different substrate affinities of each enzyme - Has1 has lower affinity for both UDP-GlcUA and UDP-GlcNAc compared to Has2 and Has3 , allowing activity assays at varying substrate concentrations to partially distinguish their contributions. Second, analyze the molecular weight distribution of produced hyaluronan, as studies suggest Has1 produces smaller hyaluronan polymers (approximately 0.12 × 10⁶ Da) compared to Has2 (up to 2 × 10⁶ Da) and Has3 (0.12-1 × 10⁶ Da) under certain conditions . Third, use isoform-specific inhibitors or blocking antibodies, if available, to selectively inhibit each Has enzyme. Fourth, employ genetic approaches using siRNA or CRISPR to knockdown/knockout individual Has isoforms and measure the resulting changes in hyaluronan synthesis. Fifth, analyze the temporal expression patterns of each isoform, as they may be differentially regulated during processes like differentiation or wound healing . Finally, examine subcellular localization differences, as Has1 shows distinct reticular patterns compared to other Has isoforms , potentially allowing separation of activity by subcellular fractionation.

How should researchers interpret apparently contradictory findings regarding Has1 function?

When confronting apparently contradictory findings regarding Has1 function, researchers should systematically analyze several key factors that might explain the discrepancies. First, consider differences in experimental models - Has1 function may vary substantially between in vitro cell culture systems and in vivo mouse models, as demonstrated by the normal phenotype of Has1 knockout mice despite Has1's significance in certain cellular contexts . Second, evaluate substrate availability across studies - Has1's uniquely low substrate affinities mean its activity is highly dependent on UDP-GlcUA and UDP-GlcNAc concentrations, which may vary dramatically between experimental systems . Third, assess potential compensatory mechanisms - other Has isoforms may mask Has1's role in some contexts but not others. Fourth, examine the specific Has1 variants being studied - alternative splicing produces multiple HAS1 transcript variants with potentially different functions . Fifth, consider the cellular context - Has1's role varies across cell types, with notable expression in mesothelial cells, fibroblasts, and mouse embryonic fibroblasts . Finally, analyze the temporal aspects of the studies - Has1's contribution may be more significant during specific developmental windows or in response to particular stimuli. By systematically addressing these factors, researchers can develop more nuanced interpretations of seemingly contradictory results.

What troubleshooting strategies are recommended when recombinant Has1 shows low activity?

When recombinant Has1 exhibits low enzymatic activity, researchers should implement a systematic troubleshooting approach focusing on Has1's unique biochemical requirements. First, verify substrate concentrations - Has1 has lower affinity for both UDP-GlcUA and UDP-GlcNAc compared to other Has isoforms , so concentrations should be significantly higher than the Km values (potentially 5-10× higher) to ensure saturation. Second, check divalent cation availability - Has1 requires Mg²⁺ or Mn²⁺ for activity , and insufficient concentrations or the presence of chelating agents in buffers could impair function. Third, assess protein folding and membrane integration - as an integral membrane protein with multiple transmembrane domains , Has1 requires proper folding and integration for activity, which may be compromised depending on the expression system. Fourth, examine post-translational modifications - if using bacterial expression systems that lack mammalian post-translational processing, critical modifications may be absent. Fifth, verify the integrity of the Has1 construct - mutations or truncations, especially in conserved regions, can dramatically reduce activity. Sixth, consider adding glucosamine treatment to cell-based systems, as this increases substrate availability and has been shown to enhance Has1 activity in a dose-dependent manner . Finally, compare activity across different Has1 expression constructs with varying tags and linker regions, as these can impact enzyme functionality.

What are the most promising areas for future research on Mouse Has1?

Several promising research directions could significantly advance our understanding of Mouse Has1. First, investigating the specific role of Has1 in cancer progression merits focused attention, given that Has1 was the most upregulated gene in aneuploid mouse embryonic fibroblasts with malignant properties . Second, exploring Has1's unique subcellular localization patterns and potential interactions with cytoskeletal elements could reveal novel regulatory mechanisms . Third, detailed structure-function studies of Has1 would help explain its distinctive substrate affinities and potentially identify targetable sites for specific inhibitors. Fourth, investigating the physiological significance of Has1's lower substrate affinities compared to other Has isoforms could reveal specialized roles in contexts where substrate concentrations fluctuate. Fifth, examining Has1's role in stem cell biology is promising, as human mesenchymal stem cells from different donors express HAS1 in variable but significant levels . Sixth, further characterization of Has1/Has3 double knockout mice under various stress conditions could uncover phenotypes not apparent under standard laboratory conditions. Finally, exploring the regulatory mechanisms controlling Has1 expression and activity could identify new therapeutic targets for conditions involving dysregulated hyaluronan production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.