Recombinant Mouse Hyaluronan synthase 3 (Has3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Has3; Hyaluronan synthase 3; Hyaluronate synthase 3; Hyaluronic acid synthase 3; HA synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Has3
Target Protein Sequence
MPVQLTTALRVVGTSLFALVVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS LFAFLEHRRMRRAGRPLKLHCSQRPRSVALCIAAYQEDPEYLRKCLRSAQRIAFPNLKVV MVVDGNRQEDTYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMERVRAVVW ASTFSCIMQKWGGKREVMYTAFKALGNSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVG GVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFL EDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTRYLRWLNQQTRWSK SYFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLV GIIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFI GLIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRC GKKPEQYSLAFAEV
Uniprot No.

Target Background

Function
Hyaluronan synthase 3 (Has3) is an enzyme that catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. As a result, it plays a crucial role in hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan has a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. Has3 is one of the isozymes responsible for this reaction.
Gene References Into Functions
  1. Gene expression patterns suggest that Has3 is the primary regulator of prenatal and postnatal HA synthesis in the tooth germ. It may contribute to the regulation of crown and root formation, maintenance of stem cell niches in the apical bud, and mineral transport in the periodontal ligament. PMID: 27289075
  2. HAS3-mediated HA synthesis following vessel injury supports key signaling pathways involved in vascular smooth muscle cell activation, enhances platelet-derived growth factor BB-mediated migration, and ultimately contributes to neointimal hyperplasia in vivo. PMID: 26586662
  3. This study demonstrates that the ablation of Has3-dependent HA leads to reduced extracellular space volume in the CA1 stratum pyramidale, epileptiform activity in the CA1 region, and epileptic seizures in the mutant mouse. PMID: 24790187
  4. Has3 exhibits expression in the developing teeth, vibrissae hair follicles, nasal cavity, and inner ear. PMID: 15765504
Database Links
Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Hyaluronan Synthase 3 (Has3) and how does it differ from other hyaluronan synthases?

Hyaluronan synthase 3 (Has3) is one of three isoforms of hyaluronan synthase enzymes (HAS1, HAS2, and HAS3) responsible for synthesizing hyaluronan, an unbranched glycosaminoglycan that is a major constituent of the extracellular matrix. Among these isoforms, Has3 appears to function more as a regulator of hyaluronan synthesis compared to other members of the NODC/HAS gene family . Has3 is distinguished by its broader tissue distribution and ability to produce shorter HA chains with distinct biological activities. Unlike HAS1 and HAS2, Has3 tends to produce lower molecular weight HA polymers that have been associated with pro-inflammatory responses and enhanced cell signaling .

What physiological processes does mouse Has3 influence?

Mouse Has3 influences several critical physiological processes, including:

  • Inflammatory response regulation, particularly in intestinal inflammation as demonstrated in dextran sodium sulfate (DSS) experimental colitis models

  • Vascular homeostasis and smooth muscle cell phenotype modulation

  • Extracellular matrix organization and remodeling

  • Leukocyte recruitment and infiltration into tissues during inflammatory processes

  • Regulation of microvasculature development and integrity

Has3 knockout studies have revealed that Has3 plays a crucial role in driving gut inflammation, with Has3 null mice showing significant protection from colitis compared to wild-type mice .

How is recombinant mouse Has3 typically produced for research applications?

The production of recombinant mouse Has3 typically involves:

  • Vector selection and design: Appropriate expression vectors containing strong promoters (such as pILPtuf) are selected and modified to include the mouse Has3 gene sequence .

  • Codon optimization: The Has3 sequence is often codon-optimized based on the expression system's codon usage preferences to enhance protein production .

  • Addition of fusion tags: To facilitate detection and purification, tags such as His-tag (His6x) are commonly added to the C-terminus of the target gene .

  • Signal peptide incorporation: To ensure secretion, signal peptides like USP45 may be added to the N-terminus of the recombinant protein .

  • Expression system selection: Depending on research needs, expression can be performed in bacterial systems (e.g., E. coli), yeast, insect cells (Spodoptera frugiperda, Sf21), or mammalian cells .

  • Purification strategies: Affinity chromatography using the incorporated tag system, followed by additional purification steps to remove contaminants .

How should researchers design knockout experiments to study Has3 function in mouse models?

When designing knockout experiments to study Has3 function in mouse models, researchers should consider the following methodological approach:

  • Knockout strategy selection:

    • Constitutive knockout: Consider potential developmental effects and compensatory mechanisms

    • Conditional knockout: Enables tissue-specific and/or time-controlled deletion using Cre-loxP systems (e.g., Myh11-CreER^T2 for smooth muscle cell-specific Has3 deletion)

    • Inducible systems: Allow temporal control of gene deletion to study acute versus chronic effects

  • Experimental controls:

    • Include both wild-type mice and single knockout controls when studying double knockouts (e.g., HAS1/HAS3 double null mice require comparison with HAS1 null and HAS3 null mice separately)

    • Use littermate controls to minimize background genetic variations

  • Phenotypic assessment parameters:

    • Histological analysis of tissue architecture and HA deposition

    • Immunohistochemistry for detecting inflammatory markers and leukocyte infiltration

    • Measurement of disease activity indices (e.g., weight loss, tissue damage scores)

    • Quantification of inflammatory cytokines (e.g., serum IL-6 levels)

    • Assessment of vascular changes and microvasculature development

  • Validation methods:

    • Confirm knockout efficiency at both mRNA (RT-PCR) and protein levels (Western blot)

    • Assess HA production using quantitative assays and specialized staining

    • Consider potential compensatory upregulation of other HAS isoforms

What are the optimal methods for detecting and quantifying hyaluronan produced by recombinant Has3?

For detecting and quantifying hyaluronan produced by recombinant Has3, researchers should employ multiple complementary approaches:

  • Histochemical methods:

    • Biotinylated hyaluronan binding protein (HABP) staining coupled with streptavidin-conjugated reporters for tissue localization

    • Semiquantitative densitometric analysis of HA staining in specific tissue compartments

  • Biochemical quantification:

    • Enzyme-linked sorbent assay (ELSA) using HABP

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine both concentration and molecular weight distribution

    • Fluorophore-assisted carbohydrate electrophoresis (FACE) for chain length analysis

  • Radiolabeling approaches:

    • Metabolic labeling with [³H]-glucosamine or [¹⁴C]-glucuronic acid precursors

    • Measurement of incorporated radiolabel into HA precipitated by cetylpyridinium chloride

  • Mass spectrometry:

    • Liquid chromatography-mass spectrometry (LC-MS/MS) for detailed structural analysis

    • Matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) for molecular weight determination

  • Cell-based functional assays:

    • CD44-dependent cell adhesion assays

    • Migration assays to assess biological activity of produced HA

How should researchers design in vitro assays to evaluate the enzymatic activity of recombinant mouse Has3?

To effectively evaluate the enzymatic activity of recombinant mouse Has3 in vitro, researchers should consider the following methodological approach:

  • Substrate preparation:

    • Prepare UDP-GlcNAc and UDP-GlcUA as substrates in optimal molar ratios

    • Use radiolabeled substrates (e.g., UDP-[¹⁴C]GlcUA or UDP-[³H]GlcNAc) for sensitive detection of newly synthesized HA

  • Reaction conditions optimization:

    • Buffer composition: Test various buffers (Tris, HEPES, phosphate) at pH range 6.5-8.0

    • Divalent cations: Determine optimal Mg²⁺ or Mn²⁺ concentrations (typically 5-20 mM)

    • Temperature and time course: Generally 37°C with time points from 15 minutes to 4 hours

    • Reducing agents: Include DTT or β-mercaptoethanol to maintain enzyme activity

  • Enzyme concentration determination:

    • Establish linear range of enzyme concentration versus activity

    • Determine specific activity (nmol substrate incorporated/min/mg protein)

  • Product analysis:

    • Size-exclusion chromatography to separate synthesized HA from substrates

    • Digestion with specific hyaluronidases to confirm product identity

    • Gel electrophoresis to analyze molecular weight distribution

  • Kinetic parameter determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km and Vmax values for both UDP-GlcNAc and UDP-GlcUA substrates

    • Evaluate potential substrate inhibition at high concentrations

  • Inhibitor studies:

    • Test known HA synthesis inhibitors (e.g., 4-methylumbelliferone derivatives)

    • Determine IC₅₀ values and inhibition mechanisms

How should researchers interpret contradictory results between Has3 knockout models and recombinant Has3 expression studies?

When faced with contradictory results between Has3 knockout models and recombinant Has3 expression studies, researchers should systematically address potential sources of discrepancy through the following analytical framework:

  • Genetic background considerations:

    • Evaluate whether knockout and expression studies were performed in the same genetic background

    • Assess potential genetic modifiers that may influence Has3 function differently across strains

    • Consider backcrossing knockout lines to match expression study backgrounds

  • Developmental compensation mechanisms:

    • Analyze expression patterns of other HAS family members (HAS1, HAS2) in knockout models

    • Compare acute versus chronic knockout effects using inducible systems

    • Distinguish between developmental adaptation and direct Has3 functions

  • Expression level disparities:

    • Quantify Has3 expression levels in recombinant systems relative to physiological levels

    • Consider dose-dependent effects where overexpression may produce qualitatively different outcomes

    • Evaluate potential threshold effects in Has3 function

  • Post-translational modifications:

    • Compare glycosylation patterns between native and recombinant Has3

    • Assess phosphorylation status and other regulatory modifications

    • Evaluate differences in subcellular localization between systems

  • Experimental context variations:

    • Analyze differences in inflammatory stimuli or disease models used

    • Compare tissue-specific versus systemic effects

    • Consider the role of the microenvironment in modulating Has3 function

  • Methodological reconciliation approach:

    • Design experiments that directly compare knockout rescue with recombinant expression

    • Implement dose-response studies with recombinant Has3 in knockout backgrounds

    • Use domain-specific mutations to identify functional regions responsible for discrepancies

What statistical approaches are most appropriate for analyzing hyaluronan distribution data in various tissue compartments?

For analyzing hyaluronan distribution data across tissue compartments, the following statistical approaches are recommended:

  • Quantitative image analysis methods:

    • Semiquantitative densitometric analysis with clearly defined regions of interest (ROIs)

    • Digital pathology algorithms for automated quantification of hyaluronan-positive areas

    • Automated intensity measurements calibrated with standard curves

  • Appropriate statistical tests:

    • Two-way ANOVA for comparing multiple genotypes across different time points or tissue compartments

    • Mixed-effects models for longitudinal studies with repeated measurements

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) when normality assumptions are violated

    • Post-hoc corrections for multiple comparisons (Tukey, Bonferroni, or Dunnett's tests)

  • Power analysis and sample size determination:

    • Calculate required sample sizes based on expected effect sizes from preliminary data

    • Use historical data variance estimates to inform power calculations

    • Consider hierarchical sampling strategies for nested data (multiple measurements per animal)

  • Correlation analysis approaches:

    • Pearson or Spearman correlation coefficients for associations between HA levels and disease parameters

    • Multivariate analyses to control for confounding variables

    • Regression models to identify predictors of HA distribution patterns

  • Visualization techniques:

    • Heat maps for spatial distribution patterns

    • Box plots for comparing distributions across experimental groups

    • Time course graphs for temporal changes in specific compartments

How can researchers accurately differentiate between Has3-specific effects and those mediated by other hyaluronan synthases?

To accurately differentiate between Has3-specific effects and those mediated by other hyaluronan synthases, researchers should implement the following methodological strategies:

  • Comparative knockout models:

    • Use single knockouts (Has1 KO, Has2 KO, Has3 KO) alongside double knockouts (Has1/Has3 double KO)

    • Compare phenotypes to identify unique versus overlapping functions

    • Implement conditional tissue-specific knockouts to limit compensatory mechanisms

  • Molecular characterization of hyaluronan products:

    • Analyze molecular weight distribution of HA in different knockout models

    • Has3 typically produces lower molecular weight HA compared to Has1 and Has2

    • Use size exclusion chromatography to distinguish HA populations

  • Isoform-specific inhibitors:

    • Apply selective chemical inhibitors when available

    • Use siRNA or shRNA approaches with validated isoform specificity

    • Implement CRISPR interference for transient isoform-specific suppression

  • Rescue experiments:

    • Perform selective re-expression of each isoform in knockout backgrounds

    • Use inducible expression systems to control timing and level of rescue

    • Engineer chimeric proteins to identify domain-specific functions

  • Temporal expression analysis:

    • Monitor expression profiles of all three Has isoforms during experimental timelines

    • Correlate disease progression with isoform-specific expression changes

    • Use real-time PCR, Western blotting, and immunohistochemistry for comprehensive profiling

  • Cell-specific expression patterns:

    • Perform single-cell RNA sequencing to identify cell populations expressing specific Has isoforms

    • Use lineage tracing combined with Has3 knockout (e.g., SMC-specific Has3 KO)

    • Implement laser capture microdissection followed by qPCR for tissue compartment analysis

How might Has3 knockout mice be utilized to investigate the role of hyaluronan in inflammatory bowel disease therapies?

Has3 knockout mice provide a powerful tool for investigating hyaluronan's role in inflammatory bowel disease (IBD) therapies through the following research approaches:

  • Therapeutic target validation:

    • Compare disease progression between wild-type and Has3 knockout mice in DSS-colitis model

    • Evaluate response to standard IBD therapeutics in both genotypes

    • Identify Has3-dependent and independent therapeutic pathways

  • Mechanistic studies:

    • Analyze the relationship between Has3-generated HA and submucosal microvasculature expansion during colitis

    • Investigate leukocyte recruitment mechanisms mediated by Has3-derived HA

    • Examine epithelial barrier function and repair processes in the absence of Has3

  • Combination therapy development:

    • Test Has3 inhibitors in combination with current IBD therapeutics

    • Evaluate synergistic effects on inflammation reduction and tissue repair

    • Develop rational combination strategies based on Has3-dependent pathways

  • Predictive biomarker identification:

    • Correlate HA fragments of specific sizes with disease severity

    • Develop blood or stool tests for Has3 activity or Has3-specific HA products

    • Establish prognostic indicators for therapy response based on Has3 activity

  • Localized therapeutic delivery systems:

    • Design colon-targeted Has3 inhibitors to minimize systemic effects

    • Develop nanoparticle-based delivery systems for Has3-targeting molecules

    • Test microbiome-based delivery of Has3-modulating factors

What are the most promising approaches for developing selective Has3 inhibitors for research applications?

Developing selective Has3 inhibitors for research applications involves several promising approaches:

  • Structure-based design strategies:

    • Utilize homology modeling and molecular docking to identify Has3-specific binding pockets

    • Focus on regions with low sequence conservation between Has isoforms

    • Design small molecules that exploit unique structural features of Has3

  • High-throughput screening platforms:

    • Develop cell-based assays with Has3-specific readouts for compound library screening

    • Implement parallel screening against all Has isoforms to identify selective hits

    • Use fragment-based approaches to identify starting scaffolds for optimization

  • Enzyme mechanism-based inhibitors:

    • Design substrate analogs that compete specifically with Has3 substrates

    • Develop mechanism-based inhibitors that form covalent adducts with Has3

    • Target unique catalytic residues or regulatory domains in Has3

  • Allosteric modulator development:

    • Identify allosteric sites unique to Has3 that affect enzyme activity

    • Design small molecules that stabilize inactive conformations of Has3

    • Develop compounds that interfere with Has3 oligomerization or membrane insertion

  • Alternative modalities:

    • Develop isoform-specific neutralizing antibodies or nanobodies

    • Design aptamers with high Has3 selectivity

    • Create engineered protein domains that interact specifically with Has3

  • Validation strategies:

    • Test candidate inhibitors in Has1/Has2 double knockout systems to confirm Has3 selectivity

    • Perform comprehensive selectivity profiling against related glycosyltransferases

    • Validate target engagement using cellular thermal shift assays or related techniques

How does Has3-derived hyaluronan interact with vascular smooth muscle cells in atherosclerosis models?

The interaction between Has3-derived hyaluronan and vascular smooth muscle cells (SMCs) in atherosclerosis models involves several complex mechanisms:

  • SMC phenotypic modulation:

    • Has3-derived HA influences SMC phenotypic switching from contractile to synthetic states

    • Has3 expression in SMCs contributes to ECM remodeling during atherosclerotic plaque formation

    • SMC-specific Has3 knockout models (SMC-Has3 KO) using Myh11-CreER^T2 systems allow direct investigation of this relationship

  • Inflammatory signaling pathways:

    • Has3-produced HA fragments interact with toll-like receptors (TLRs) on SMCs

    • These interactions trigger NF-κB signaling cascades leading to inflammatory cytokine production

    • CD44-dependent and independent pathways mediate Has3-HA effects on SMC inflammatory responses

  • Microvascular proliferation:

    • Has3 expression correlates with increased submucosal microvasculature in inflammatory conditions

    • This finding suggests potential similar mechanisms in vasa vasorum expansion during atherosclerosis

    • Has3-derived HA may promote angiogenesis within developing atherosclerotic plaques

  • Leukocyte recruitment and retention:

    • Has3-derived HA creates a permissive environment for leukocyte adhesion to vascular surfaces

    • Macrophage retention within atherosclerotic plaques may be influenced by Has3-dependent mechanisms

    • Interactions with proteins like Semaphorin 3E may regulate these processes

  • Experimental approaches:

    • Combinatorial SMC-lineage tracing and SMC-specific Has3 knockout models provide powerful tools

    • Atherosclerotic plaque composition analysis in Has3-deficient models reveals mechanistic insights

    • In vitro co-culture systems with defined HA molecular weights help dissect direct versus indirect effects

What is the current understanding of the genetic regulation of Has3 expression in different tissues and disease states?

The current understanding of genetic regulation of Has3 expression across tissues and disease states encompasses several key aspects:

  • Transcriptional regulation:

    • Promoter analysis reveals binding sites for inflammation-responsive transcription factors (NF-κB, AP-1)

    • Tissue-specific transcription factors contribute to differential expression patterns

    • Epigenetic modifications (DNA methylation, histone modifications) modulate baseline and inducible expression

  • Post-transcriptional control:

    • Alternative splicing produces multiple transcript variants with potentially distinct functions

    • microRNA-mediated regulation affects Has3 mRNA stability and translation efficiency

    • RNA-binding proteins contribute to tissue-specific expression patterns

  • Signaling pathway integration:

    • Inflammatory cytokines (TNF-α, IL-1β) strongly induce Has3 expression in multiple cell types

    • Growth factor signaling (EGF, PDGF, TGF-β) differentially regulates Has3 versus other HAS isoforms

    • Metabolic regulators influence Has3 expression, connecting metabolic state to HA production

  • Disease-specific regulation:

    • Intestinal inflammation dramatically increases Has3 expression in colitis models

    • Vascular injury and atherosclerosis alter Has3 expression in smooth muscle cells

    • Cancer cells frequently exhibit dysregulated Has3 expression contributing to tumor microenvironment

  • Species conservation and divergence:

    • Has3 is highly conserved across vertebrate species

    • Species-specific regulatory elements may contribute to differential expression patterns

    • Comparative genomics approaches help identify conserved regulatory mechanisms

  • Experimental approaches:

    • Reporter gene assays for promoter analysis

    • ChIP-seq for identifying transcription factor binding patterns

    • CRISPR screening for regulatory element identification

    • Single-cell transcriptomics for cell-specific expression profiling

What are the common challenges in producing functional recombinant mouse Has3 protein and how can they be addressed?

Producing functional recombinant mouse Has3 protein presents several challenges that can be systematically addressed:

  • Protein solubility and membrane integration issues:

    • Challenge: Has3 is a multi-pass transmembrane protein that often aggregates when overexpressed

    • Solution: Use specialized expression systems like insect cells (Spodoptera frugiperda)

    • Alternative approach: Express soluble domains separately for structure-function studies

    • Optimization strategy: Test various detergents and solubilization buffers for extraction

  • Post-translational modification requirements:

    • Challenge: Mammalian glycosylation patterns may be essential for full Has3 activity

    • Solution: Select expression systems capable of mammalian-like glycosylation (CHO cells)

    • Verification method: Compare glycosylation patterns between native and recombinant protein

    • Enhancement approach: Co-express necessary glycosyltransferases in the production system

  • Substrate availability for activity assessment:

    • Challenge: Ensuring adequate UDP-sugar substrates for enzymatic activity testing

    • Solution: Supplement reaction buffers with freshly prepared UDP-GlcUA and UDP-GlcNAc

    • Alternative approach: Co-express substrate-generating enzymes

    • Verification method: Monitor substrate depletion during activity assays

  • Protein stability concerns:

    • Challenge: Recombinant Has3 often exhibits limited stability during purification and storage

    • Solution: Include stabilizers like glycerol (10-20%) and reducing agents

    • Optimization strategy: Test various buffer compositions and pH conditions

    • Storage recommendation: Store at -80°C in single-use aliquots to avoid freeze-thaw cycles

  • Activity verification methods:

    • Challenge: Confirming that recombinant Has3 retains physiological activity

    • Solution: Implement multiple complementary activity assays

    • Functional test: Compare HA production in Has3-deficient cells with and without recombinant protein

    • Quality control: Analyze size distribution of produced HA to confirm enzyme functionality

How can researchers optimize immunohistochemical detection of hyaluronan in tissue sections from Has3 experimental models?

To optimize immunohistochemical detection of hyaluronan in tissue sections from Has3 experimental models, researchers should follow these methodological guidelines:

  • Sample preparation optimization:

    • Fixation protocol: Use 4% paraformaldehyde with controlled fixation time (4-24 hours)

    • Alternative approach: Consider zinc-based fixatives that better preserve HA structure

    • Processing consideration: Minimize dehydration time to prevent HA extraction

    • Section thickness: Prepare 5-7 μm sections for optimal staining and visualization

  • Specific HA detection reagents:

    • Primary detection: Use biotinylated hyaluronan binding protein (HABP) derived from cartilage

    • Validation approach: Include hyaluronidase-treated control sections to confirm specificity

    • Signal amplification: Implement streptavidin-conjugated detection systems

    • Multiplexing strategy: Combine with antibodies against HA receptors (CD44) or Has3 itself

  • Staining protocol optimization:

    • Blocking strategy: Use 1% BSA with 0.3% Triton X-100 to reduce background

    • Incubation conditions: Extend HABP incubation to overnight at 4°C for complete penetration

    • Washing steps: Implement extensive washing with PBS containing 0.05% Tween-20

    • Antigen retrieval: Test whether mild retrieval improves staining without degrading HA

  • Quantification approaches:

    • Region selection: Define standardized regions for analysis (e.g., lamina propria, submucosa)

    • Imaging parameters: Maintain consistent exposure and gain settings across samples

    • Analytical method: Use semiquantitative densitometric analysis with defined ROIs

    • Automation option: Implement digital pathology algorithms for unbiased quantification

  • Controls and validation:

    • Positive control: Include known HA-rich tissues (umbilical cord) in each staining batch

    • Negative control: Process adjacent sections with hyaluronidase pre-treatment

    • Genotype controls: Compare staining patterns between wild-type, Has1 null, and Has3 null tissues

    • Correlation validation: Relate staining intensity to biochemically measured HA content

What are the key considerations when designing experiments to evaluate Has3 involvement in pathological conditions beyond inflammatory bowel disease?

When designing experiments to evaluate Has3 involvement in pathological conditions beyond inflammatory bowel disease, researchers should consider these key methodological aspects:

  • Model selection and validation:

    • Disease relevance: Select models where Has3-derived HA likely plays a mechanistic role

    • Validation approach: Confirm Has3 expression changes in the target pathological condition

    • Comparative strategy: Include models for related diseases to identify condition-specific roles

    • Temporal considerations: Evaluate Has3 involvement during different disease stages

  • Genetic manipulation strategies:

    • Tissue specificity: Use conditional Has3 knockout systems targeting relevant cell types

    • Temporal control: Implement inducible systems to distinguish developmental from acute effects

    • Dose dependency: Consider heterozygous models to evaluate gene dosage effects

    • Combinatorial approach: Create double knockouts with related genes to identify redundancies

  • Mechanistic dissection approaches:

    • Pathway analysis: Evaluate inflammatory signaling pathways potentially regulated by Has3

    • Receptor involvement: Assess CD44, RHAMM, and TLR dependency of Has3 effects

    • Molecular specificity: Determine whether effects are due to HA synthesis rate or HA size

    • Cell type interactions: Investigate how Has3-derived HA mediates cell-cell communication

  • Translational relevance assessment:

    • Human correlation: Compare findings with Has3 expression patterns in human disease samples

    • Therapeutic potential: Test Has3 inhibition at different disease stages

    • Biomarker development: Evaluate Has3-dependent HA fragments as disease indicators

    • Combination approaches: Test Has3 modulation with standard-of-care treatments

  • Technical considerations:

    • Tissue-specific analysis: Develop protocols optimized for the target tissue

    • HA size determination: Implement size exclusion chromatography for tissue extracts

    • Functional assessment: Develop relevant readouts for disease-specific Has3 functions

    • Quantitative analysis: Establish disease-relevant parameters for objective assessment

How might Has3-specific therapeutic approaches differ from general hyaluronan-targeting strategies?

Has3-specific therapeutic approaches would differ fundamentally from general hyaluronan-targeting strategies in several important ways:

  • Mechanistic selectivity advantages:

    • Targeted inflammation control: Has3-specific inhibition would preferentially reduce pro-inflammatory low-molecular-weight HA production

    • Preservation of homeostatic functions: Has3 targeting would maintain Has1/Has2-mediated structural and protective HA functions

    • Reduced side effects: More selective intervention would minimize disruption of essential HA functions

    • Disease specificity: Has3-selective approaches would target pathways specifically upregulated in disease states

  • Potential therapeutic modalities:

    • Small molecule inhibitors: Compounds targeting Has3-specific catalytic or regulatory domains

    • Antisense oligonucleotides: Reduction of Has3 expression through targeted RNA degradation

    • CRISPR-based approaches: Therapeutic gene editing to modify Has3 function in specific tissues

    • Antibody-based strategies: Neutralizing antibodies specific to Has3 protein or Has3-produced HA fragments

  • Disease-specific applications:

    • Inflammatory bowel disease: Temporary targeted intervention during flares based on protective effects in Has3 null mice

    • Vascular inflammation: Modulation of SMC-derived Has3 to control atherosclerotic progression

    • Fibrotic disorders: Targeting Has3-mediated inflammatory phases while preserving tissue repair functions

    • Cancer microenvironment modulation: Selective inhibition of Has3-dependent tumor-promoting inflammation

  • Biomarker-guided approach:

    • Patient stratification: Identify subgroups with Has3-predominant HA production

    • Response prediction: Develop biomarkers for Has3-dependent disease mechanisms

    • Real-time monitoring: Track Has3-specific HA fragments during treatment

    • Combination therapy guidance: Use Has3 activity markers to inform optimal therapeutic combinations

  • Delivery considerations:

    • Tissue targeting: Design delivery systems for tissues with pathological Has3 activity

    • Temporal control: Develop formulations allowing pulsatile inhibition during disease flares

    • Local administration: For conditions like IBD, consider topical or localized delivery

    • Cell-specific targeting: Engineer approaches that selectively target Has3 in disease-relevant cell populations

What are the most promising research directions for understanding the molecular mechanisms of Has3 regulation?

The most promising research directions for understanding Has3 regulation at the molecular level include:

  • Structural biology approaches:

    • Cryo-EM analysis: Determine the three-dimensional structure of Has3 in membrane environments

    • Site-directed mutagenesis: Identify critical regulatory residues through systematic mutation

    • Molecular dynamics simulations: Model conformational changes associated with enzyme activation

    • Protein-protein interaction mapping: Characterize the Has3 interactome in different cellular contexts

  • Post-translational modification profiling:

    • Phosphoproteomics: Identify regulatory phosphorylation sites on Has3

    • Glycosylation analysis: Determine how glycan modifications affect Has3 activity and stability

    • Ubiquitination studies: Characterize degradation pathways and stability regulation

    • Redox sensitivity: Investigate how oxidative stress affects Has3 function through cysteine modifications

  • Transcriptional and epigenetic regulation:

    • Promoter characterization: Define tissue-specific and condition-responsive regulatory elements

    • Epigenetic profiling: Map DNA methylation and histone modifications across disease conditions

    • Chromatin immunoprecipitation: Identify transcription factors driving Has3 expression

    • Alternative splicing analysis: Characterize functional implications of Has3 splice variants

  • Metabolic control mechanisms:

    • Substrate availability regulation: Determine how UDP-sugar metabolism influences Has3 activity

    • Metabolic sensing: Investigate links between cellular energy status and Has3 function

    • Membrane microdomain localization: Characterize how lipid environment affects Has3 activity

    • Feedback inhibition: Identify how HA accumulation modulates Has3 expression and function

  • Advanced technological approaches:

    • Single-molecule enzymology: Measure Has3 kinetics at the individual molecule level

    • Super-resolution microscopy: Visualize Has3 localization and trafficking with nanoscale precision

    • Optogenetic control: Develop light-responsive Has3 variants for real-time activity modulation

    • CRISPR screens: Identify novel regulators of Has3 expression and function

How might recombinant mouse Has3 be utilized to develop new research tools for studying hyaluronan biology?

Recombinant mouse Has3 offers significant potential for developing novel research tools to advance hyaluronan biology:

  • Engineered Has3 variants for mechanistic studies:

    • Activity-tunable Has3: Create mutants with controllable catalytic rates

    • Substrate specificity variants: Engineer Has3 to incorporate modified sugars for HA labeling

    • Fluorescent fusion proteins: Develop Has3-FP fusions for real-time visualization

    • Optogenetic Has3: Create light-responsive variants for spatiotemporal control of HA synthesis

  • Has3-based biosensors and reporters:

    • HA production reporters: Develop systems linking Has3 activity to fluorescent readouts

    • Has3 localization probes: Create tools to monitor Has3 trafficking and membrane organization

    • Interaction sensors: Design FRET-based systems to monitor Has3-protein interactions

    • Microdomain markers: Utilize Has3 as a probe for specialized membrane regions

  • Has3-derived research reagents:

    • Size-defined HA production: Generate precisely sized HA oligomers for functional studies

    • Modified HA polymers: Produce HA incorporating bioorthogonal handles for click chemistry

    • Affinity reagents: Develop Has3-based probes for capturing HA-binding proteins

    • Structure-function libraries: Create Has3 variant collections for structure-activity relationship studies

  • Cell-based systems for hyaluronan biology:

    • Inducible Has3 expression systems: Create cell lines with tunable Has3 levels

    • Has3-null reporter cells: Develop platforms for complementation studies

    • Multi-color HA visualization: Engineer cells expressing Has3 variants producing differentially labeled HA

    • Organoid models: Establish 3D culture systems with controlled Has3 expression

  • In vivo research applications:

    • Conditional expression models: Develop mouse lines with inducible tissue-specific Has3 expression

    • Reporter mice: Create animals with Has3 promoter-driven fluorescent proteins

    • Humanized Has3 models: Generate mice expressing human HAS3 for translational studies

    • In vivo imaging tools: Develop Has3-based systems for visualizing HA dynamics in living animals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.