Recombinant Mouse Hydroxycarboxylic acid receptor 1 (Hcar1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

ParameterValue
Gene NameHcar1 (GPR81, GPR104, HCA1)
Chromosomal LocationMouse: 12q15; Human: 12q24.31
Protein Length343 amino acids (mouse)
Transmembrane Domains7 (Class A GPCR)
LigandL-lactate (physiological); 3-chloro-5-hydroxybenzoic acid (3Cl-HBA), 3,5-dihydroxybenzoic acid (3,5-DHBA)
Signaling PathwayGαi/o → ↓ cAMP → ↓ Protein Kinase A (PKA) activity

Key Functional Domains:

  • Extracellular N-terminus: Binds lactate and synthetic agonists.

  • Transmembrane Helices: Mediate G-protein coupling.

  • Intracellular C-terminus: Interacts with βγ subunits for cross-talk with other receptors (e.g., GABA_B, adenosine A1) .

Production Methods and Purity

Recombinant Hcar1 is produced via heterologous expression systems, optimized for structural integrity and functional activity:

Expression SystemHostPurityApplications
Bacterial (E. coli)E. coli≥85% (SDS-PAGE)High-yield production; ideal for ligand-binding assays
YeastPichia pastoris≥85%Improved folding; used for structural studies
Baculovirus/Insect CellsSf9 cells≥85%Native-like post-translational modifications
Mammalian CellsHEK293/CHO>95% (affinity)Functional studies (e.g., cAMP assays)

Challenges:

  • E. coli: Lacks mammalian-specific glycosylation.

  • Mammalian Systems: Higher cost but critical for receptor activity.

Metabolic Regulation

  • Lipolysis Suppression: Hcar1 activation by lactate inhibits cAMP-PKA signaling in adipocytes, reducing lipolysis .

  • Insulin Sensitivity: Mediates insulin-induced suppression of lipolysis in the fed state .

Neuronal Modulation

  • Presynaptic Inhibition: Reduces miniature excitatory postsynaptic currents (mEPSCs) and increases paired-pulse ratio (PPR), indicating presynaptic action .

  • Excitability Reduction: Hyperpolarizes resting membrane potential (RMP), decreases input resistance (R_N), and slows membrane time constant .

  • Calcium Spiking: Agonists (e.g., 3Cl-HBA) decrease spontaneous calcium spiking by ~40% in cortical neurons .

Cancer Biology

ModelObservationReference
Pancreatic/Breast CancerHcar1 enhances tumor growth, metastasis, and survival; required for HER2+ and triple-negative breast cancer cell viability
DNA Damage RepairLactate via Hcar1 activates nuclear ERK/AKT pathways, promoting repair and therapy resistance

Neuroprotection

ModelObservationReference
Middle Cerebral Artery Occlusion (MCAO)Hcar1 agonists (CHBA/DHBA) reduce infarct volume and improve behavioral outcomes in mice
EpilepsyHCAR1 expression detected in human epileptic brain tissue; agonists suppress neuronal hyperexcitability

Gut Microbiota Interactions

MechanismEffectReference
Lactate from LactobacillusPromotes intestinal stem cell proliferation via Wnt/β-catenin signaling

Challenges and Considerations

  1. Antibody Specificity: Commercial antibodies often fail to distinguish Hcar1 in knockout (KO) mice, necessitating transgenic reporters (e.g., mRFP-Hcar1) .

  2. Nuclear Localization: Recent studies identify nuclear Hcar1 (N-Hcar1) interacting with chromatin remodelers and regulating gene expression .

  3. Species-Specific Differences: Mouse Hcar1 (343 aa) vs. human HCAR1 (346 aa) requires cautious extrapolation .

Future Directions

  • Therapeutic Targeting: Development of Hcar1 agonists/antagonists for epilepsy, stroke, and cancer.

  • Nuclear Signaling: Investigating N-Hcar1’s role in transcriptional regulation and non-canonical pathways .

  • Cross-Talk Studies: Elucidating interactions with GABA_B, adenosine A1, and α2A-adrenergic receptors .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our standard shipping includes blue ice packs. If dry ice is required, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form, on the other hand, has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
Hcar1; Gpr81; Hydroxycarboxylic acid receptor 1; G-protein coupled receptor 81
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDNGSCCLIEGEPISQVMPPLLILVFVLGALGNGIALCGFCFHMKTWKSSTIYLFNLAVA DFLLMICLPLRTDYYLRRRHWIFGDIACRLVLFKLAMNRAGSIVFLTVVAVDRYFKVVHP HHMVNAISNRTAAATACVLWTLVILGTVYLLMESHLCVQGTLSSCESFIMESANGWHDVM FQLEFFLPLTIILFCSVNVVWSLRRRQQLTRQARMRRATRFIMVVASVFITCYLPSVLAR LYFLWTVPTSACDPSVHTALHVTLSFTYLNSMLDPLVYYFSSPSLPKFYTKLTICSLKPK RPGRTKTRRSEEMPISNLCSKSSIDGANRSQRPSDGQWDLQVC
Uniprot No.

Target Background

Function
Hydroxycarboxylic acid receptor 1 (Hcar1) acts as a receptor for L-lactate, mediating its anti-lipolytic effect through a G(i)-protein-mediated pathway.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in subcutaneous fat and omental fat and detectable in lower levels in brain and many other tissues. High levels detected in epididymal and subcutaneous fat with slightly lower in omental fat, low levels are detected in the brain, skeletal

Q&A

What is Hydroxycarboxylic Acid Receptor 1 (Hcar1) and what are its key characteristics?

Hydroxycarboxylic Acid Receptor 1 (Hcar1), also known as Gpr81, is a G-protein-coupled receptor that responds to lactate as its endogenous ligand. In mice, Hcar1 is expressed in various tissues, with particularly important functions in neuronal cells. This receptor functions through Giα-protein-mediated signaling, primarily engaging the adenylyl cyclase-cAMP-protein kinase A axis to modulate cellular activity. Structurally, it belongs to the superfamily of G-protein-coupled receptors with seven transmembrane domains .

For researchers, it's important to note that Hcar1 has several alternative names in the literature, including Gpr81 in mouse models. The human ortholog is denoted as HCAR1 (or GPR81, HCA1, LACR1, among other designations) . When designing experiments, researchers should be aware of these nomenclature variations to ensure comprehensive literature review.

How does Hcar1 signaling affect neuronal function?

Hcar1 activation in neurons produces significant modulatory effects on neuronal activity through several mechanisms:

  • Decrease in miniature EPSC frequency

  • Increase in paired-pulse ratio

  • Reduction in firing frequency

  • Modulation of membrane intrinsic properties

These effects are mediated through a Giα-protein signaling pathway. The receptor engages both Giα and Giβγ intracellular pathways to functionally interact with other G-protein-coupled receptors including adenosine A1, GABA B, and α2A-adrenergic receptors, resulting in complex modulation of neuronal network activity .

Methodologically, these effects can be studied using whole-cell patch clamp techniques on primary cortical neurons from wild-type and Hcar1 knockout mice. Fast calcium imaging can also be employed to observe that Hcar1 agonists decrease spontaneous calcium spiking activity by approximately 40% in wild-type neurons but not in Hcar1 knockout neurons .

What are the common recombinant forms of mouse Hcar1 used in research?

Several recombinant forms of mouse Hcar1 are commonly used in research settings:

  • Full-length Recombinant Mouse Hydroxycarboxylic acid receptor 1 (Hcar1) - typically expressed in cell-free expression systems with purity ≥85% as determined by SDS-PAGE

  • Partial Recombinant Mouse Hydroxycarboxylic acid receptor 1 (Hcar1) - expressed in various systems including E. coli, yeast, baculovirus, or mammalian cells

  • Tagged variants - often incorporating epitope tags such as HA for detection and purification purposes

When selecting a recombinant form for your research, consider the expression system's impact on protein folding and post-translational modifications, which may affect receptor functionality in downstream applications.

How do naturally occurring Hcar1 mutations affect receptor function and what experimental approaches best characterize these effects?

Several naturally occurring Hcar1 mutations have been identified that result in loss of function. The variants A110V, S172L, and D253H show reduced basal activity, while S172L specifically displays decreased potency in response to the endogenous ligand L-lactate. Both S172L and D253H variants exhibit impaired cell surface expression, which partially explains their reduced activity .

For characterizing these effects, a multi-faceted experimental approach is recommended:

  • Luciferase reporter gene assays - To assess basal and ligand-induced signaling after transient expression in human embryonic kidney 293 cells

  • Surface expression analysis - Using HA-tagged receptor constructs and HRP-conjugated antibodies to quantify cell surface versus total receptor expression

  • Functional assessment - Using forskolin-stimulated cAMP production and subsequent inhibition as a quantifiable index of Gαi-mediated signaling

When designing mutation studies, researchers should incorporate both wild-type and mutant receptors in parallel experiments, along with appropriate empty vector controls. It's important to note that L-lactate at high concentrations can nonspecifically affect certain cAMP assays, potentially confounding results .

What is the role of Hcar1 in seizure susceptibility and how can this be experimentally investigated?

Recent research has revealed that Hcar1 plays a crucial role in modulating epileptic seizure activity. HCAR1-deficient mice (HCAR1-KO) exhibit:

  • Lowered seizure thresholds

  • Increased seizure severity and duration

  • Enhanced hippocampal and whole-brain electrographic seizure activity

  • Prolonged recovery time from seizures with delayed return to baseline

These findings suggest that Hcar1 activation serves as an endogenous protective mechanism against excessive neuronal excitation. The activation of Hcar1 appears to be closely associated with glycolytic output, as inhibition of lactate dehydrogenase A produces similar effects to Hcar1 knockout .

To investigate this experimentally, researchers can employ:

  • EEG recordings - To capture time-frequency analysis of seizure activity

  • Acute hippocampal slice preparations - To study inter-ictal activity under controlled conditions

  • Pharmacological approaches - Using lactate dehydrogenase inhibitors to modulate endogenous ligand availability

  • Spectral analysis of seizure power - Quantifying frequency ranges (delta, theta, alpha, and HFO bands)

A comprehensive experimental design should include both behavioral and electrophysiological readouts, with particular attention to seizure threshold, duration, and post-ictal recovery phases .

How does Hcar1 interact with other G-protein-coupled receptors to modulate neuronal activity?

Hcar1 exhibits complex interactions with other G-protein-coupled receptors to fine-tune neuronal activity. Specifically, Hcar1 interacts with adenosine A1, GABA B, and α2A-adrenergic receptors through mechanisms involving both its Giα and Giβγ subunits .

To study these interactions methodologically:

  • Co-immunoprecipitation can detect physical interactions between receptors

  • BRET/FRET approaches can monitor receptor proximity and potential dimerization

  • Electrophysiological recordings with specific agonists/antagonists can reveal functional interactions

  • Signaling studies using the Gαq5i66V experimental design can direct signaling of a Gαi-coupled receptor to stimulation of a Gαq-dependent reporter gene

When investigating receptor interactions, it's critical to account for potential cross-talk between signaling pathways. Experimental designs should include appropriate controls with selective receptor antagonists to distinguish direct from indirect interactions .

What are the optimal expression systems for producing functional recombinant mouse Hcar1?

Several expression systems have been successfully employed for producing functional recombinant mouse Hcar1, each with specific advantages and limitations:

Expression SystemAdvantagesLimitationsTypical YieldApplications
Cell-Free ExpressionRapid production, fewer contaminantsLimited post-translational modifications≥85% purity by SDS-PAGEStructural studies, antibody production
E. coliCost-effective, high yieldLimited glycosylationVariableAntigenic fragment production
Yeast/BaculovirusBetter folding, some post-translational modificationsMore complex protocols≥85% purity by SDS-PAGEFunctional studies
Mammalian CellNative-like post-translational modificationsHigher cost, lower yieldVariableFunctional assays, signaling studies

For functional studies examining signaling pathways, mammalian expression systems (typically HEK293 cells) are preferred as they provide the cellular machinery necessary for proper receptor folding, trafficking, and signaling .

When expressing Hcar1, it's advisable to incorporate epitope tags (such as HA) to facilitate detection and quantification. For optimal surface expression, researchers should validate expression by comparing permeabilized versus non-permeabilized conditions to distinguish total from surface-expressed receptor .

How can researchers effectively assess Hcar1 activation and signaling in neuronal models?

Assessing Hcar1 activation and signaling in neuronal models requires multiple complementary approaches:

  • Whole-cell patch clamp - To measure changes in miniature EPSC frequency, paired-pulse ratio, firing frequency, and membrane properties

  • Fast calcium imaging - To observe decreases in spontaneous calcium spiking activity (approximately 40% reduction with Hcar1 agonists)

  • Reporter gene assays - Using luciferase constructs responsive to cAMP signaling pathways

  • Forskolin inhibition assays - To quantify Gαi-mediated signaling by measuring inhibition of forskolin-stimulated cAMP production

When designing these experiments, researchers should include both wild-type and Hcar1 knockout neurons as controls. It's noteworthy that in neurons lacking Hcar1, basal activity is increased compared to wild-type neurons, providing an important internal validation of receptor function .

For pharmacological activation, several agonists can be employed:

  • 3,5-dihydroxybenzoic acid

  • 3-chloro-5-hydroxybenzoic acid (3Cl-HBA)

  • Lactate (endogenous ligand)

What are common challenges in interpreting Hcar1 knockout phenotypes and how can researchers address them?

Interpreting Hcar1 knockout phenotypes presents several challenges that researchers should address methodically:

  • Compensatory mechanisms - Long-term Hcar1 deficiency may trigger upregulation of alternative pathways. Solution: Complement constitutive knockout studies with acute receptor inhibition or conditional knockout models.

  • Background strain effects - Different mouse strains may show variable phenotypes when Hcar1 is deleted. Solution: Use littermate controls and consider backcrossing to eliminate strain-specific effects.

  • Developmental confounds - Constitutive Hcar1 knockout may affect development. Solution: Employ inducible knockout strategies to distinguish developmental from acute effects.

  • Specificity of phenotypes - Distinguishing direct from indirect effects of Hcar1 deletion. Solution: Conduct rescue experiments with exogenous Hcar1 expression to confirm phenotype specificity.

  • Variability in seizure models - HCAR1-KO mice show increased seizure severity, but individual variability can be high. Solution: Increase sample sizes and employ multiple seizure induction protocols to establish robust phenotypes .

When studying seizure phenotypes specifically, researchers should employ comprehensive electrographic seizure analysis, including time-frequency analysis across multiple frequency bands (delta, theta, alpha, and HFO) to fully characterize the altered patterns in Hcar1 knockout models .

How can researchers differentiate between Hcar1-specific effects and off-target effects when using pharmacological tools?

Differentiating between Hcar1-specific and off-target effects requires rigorous experimental design:

  • Use of knockout controls - Test compounds in both wild-type and Hcar1 knockout preparations. Hcar1-specific effects should be absent in knockout models.

  • Dose-response relationships - Establish complete dose-response curves to identify potential off-target effects that typically emerge at higher concentrations.

  • Multiple structurally distinct agonists - Compare effects of different Hcar1 agonists (3,5-dihydroxybenzoic acid, 3Cl-HBA, and lactate). Consistent effects across chemically diverse agonists suggest receptor specificity .

  • Receptor mutants - Utilize partial loss-of-function mutants (e.g., S172L variant with decreased potency to L-lactate) to confirm mechanism .

  • Pathway inhibitors - Apply specific inhibitors of downstream signaling components to confirm pathway engagement.

It's important to note that when using L-lactate as an agonist, researchers should be aware that high concentrations can nonspecifically affect certain assay readouts. Control experiments with unrelated Gαi-coupled receptors (e.g., mu opioid receptor) can help identify such confounds .

What are the emerging therapeutic applications of Hcar1 modulation in neurological disorders?

The role of Hcar1 in neurological disorders, particularly epilepsy, represents an emerging frontier for therapeutic intervention. Recent findings that HCAR1-deficient mice exhibit lowered seizure thresholds and increased seizure severity suggest that Hcar1 agonists might have anticonvulsant potential .

Key research directions include:

  • Development of brain-penetrant selective Hcar1 agonists - Current compounds like 3Cl-HBA provide proof-of-concept, but optimization for CNS penetration and receptor selectivity is needed.

  • Investigation of Hcar1 in additional neurological conditions - Beyond epilepsy, Hcar1's role in downmodulating neuronal activity suggests potential applications in other hyperexcitability disorders.

  • Exploration of combination therapies - Given Hcar1's interaction with other inhibitory receptors (adenosine A1, GABA B), combination approaches targeting multiple receptors may yield synergistic effects.

  • Targeting Hcar1 signaling components - For conditions where direct receptor activation is challenging, modulating downstream signaling components may provide alternative therapeutic approaches.

When designing studies to explore these therapeutic applications, researchers should consider both acute anticonvulsant effects and potential disease-modifying properties through chronic Hcar1 modulation .

How can advanced genetic tools enhance our understanding of Hcar1 biology?

Advanced genetic tools offer powerful approaches to deepen our understanding of Hcar1 biology:

  • Reporter mouse lines - Hcar1 mRFP (Gpr109a mRFP) reporter mouse lines enable visualization of receptor expression patterns across tissues. Similar approaches could be developed specifically for Hcar1 to track expression in various physiological and pathological conditions .

  • CRISPR/Cas9 genome editing - Generation of specific point mutations (e.g., recreating naturally occurring variants like S172L) in endogenous Hcar1 to study functional consequences in vivo.

  • Cell-type specific conditional knockouts - Selective deletion of Hcar1 in specific neuronal populations to dissect cell-type-specific functions.

  • Optogenetic/chemogenetic approaches - Development of light or ligand-controlled Hcar1 variants to achieve temporal control over receptor activation.

  • Single-cell transcriptomics - Profiling Hcar1 expression at single-cell resolution to identify specific cellular populations that express the receptor under various conditions.

These advanced tools can help address fundamental questions about Hcar1 biology, including cell-type-specific roles, temporal dynamics of receptor activation, and interactions with other signaling systems. When implementing these approaches, researchers should carefully validate new genetic tools and consider potential compensatory adaptations .

What are the recommended best practices for ensuring reproducibility in Hcar1 research?

To ensure reproducibility in Hcar1 research, investigators should adhere to the following best practices:

  • Detailed reporting of experimental conditions - Specify exact cell lines, passage numbers, transfection methods, and reagent concentrations used in all experiments.

  • Validation of antibodies and tools - Confirm specificity of Hcar1 antibodies using knockout controls and report catalog numbers and dilutions.

  • Standardized pharmacological approaches - Report complete dose-response relationships and use multiple structurally distinct agonists to confirm receptor-specific effects.

  • Comprehensive controls - Include empty vector controls, unrelated receptor controls, and knockout models as appropriate validation steps.

  • Multiple readouts of receptor function - Combine measurements of receptor expression, ligand binding, and downstream signaling to provide converging evidence of receptor activity.

  • Transparent data sharing - Make raw data, analysis scripts, and detailed protocols available to the research community.

When studying naturally occurring Hcar1 variants, researchers should be particularly attentive to experimental design, as these variants may exhibit subtle phenotypes that require careful quantification of multiple parameters including basal activity, ligand-induced signaling, and surface expression .

What are the key outstanding questions in Hcar1 research that warrant further investigation?

Despite significant progress, several key questions about Hcar1 biology remain unanswered and warrant further investigation:

  • Physiological significance of endogenous lactate-Hcar1 signaling - How does this pathway contribute to normal brain function and homeostasis beyond pathological conditions like seizures?

  • Regulation of Hcar1 expression - What factors control Hcar1 levels in different cell types, and how does expression change under various physiological and pathological conditions?

  • Structural determinants of ligand specificity - Which specific amino acid residues are critical for lactate binding versus binding of synthetic agonists?

  • Cell-type specific functions - Does Hcar1 serve different roles in neurons versus glial cells or in different neuronal subtypes?

  • Interaction with metabolic pathways - How does Hcar1 signaling integrate with broader cellular metabolism, particularly under conditions of metabolic stress?

  • Therapeutic potential beyond epilepsy - Could Hcar1 modulation be beneficial in other neurological or metabolic disorders?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.