Recombinant Mouse Hydroxycarboxylic acid receptor 2 (Hcar2)

Shipped with Ice Packs
In Stock

Description

Ligand Recognition and Signaling

Hcar2 binds endogenous ligands such as β-hydroxybutyrate and butyrate, as well as the pharmacological agent niacin (nicotinic acid). These interactions inhibit adenylyl cyclase via Gi/o protein coupling, reducing cAMP levels and modulating downstream pathways . Key structural insights:

LigandReceptor InteractionFunctional OutcomeSource
NiacinBinds R111<sup>3.36</sup>, S179<sup>5.52</sup>, Y284<sup>7.43</sup>Apoptosis in neutrophils; reduced lipolysis
β-HydroxybutyrateActivates receptor under fasting conditionsMetabolic adaptation, anti-inflammatory effects
MK-6892High selectivity due to extended binding pocket; displaces niacin (IC<sub>50</sub> ~100 nM)Therapeutic target for metabolic disorders

Neurological and Immune Functions

  • Alzheimer’s Disease (AD): Hcar2 expression increases in microglia during amyloid pathology. Genetic deletion exacerbates plaque burden and cognitive deficits, while niacin activation (e.g., via Niaspan) reduces pathology .

  • Immune Regulation: Hcar2+ neutrophils and monocytes infiltrate inflamed tissues (e.g., in epidermolysis bullosa acquisita). DMF (a HCAR2 agonist) suppresses inflammation but requires Hcar2 for efficacy .

In Vivo Models

ModelObservationRelevanceSource
5xFAD Mice (AD)Hcar2 deficiency ↑ plaque burden; niacin ↓ pathology via microglial modulationTherapeutic potential for AD
EBA MiceHcar2+ cells infiltrate lesions; DMF efficacy depends on Hcar2 expressionImmune-mediated diseases (e.g., psoriasis)

Comparative Analysis with Human HCAR2

AttributeMouse Hcar2Human HCAR2Source
UniProt IDQ9EP66Q8TDS4
AA Length360 amino acids363 amino acids
Ligand AffinityNiacin (IC<sub>50</sub> ~1 mM)Niacin (IC<sub>50</sub> ~0.1 mM)
Expression SystemE. coliE. coli or mammalian cells
TagHisHis, Fc, DDK, or MYC

Quality Control

  • Purity: >90% confirmed via SDS-PAGE .

  • Function: Validated in ligand-binding and signaling assays (e.g., cAMP inhibition) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include this information in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Hcar2; Gpr109; Gpr109a; Gpr109b; Niacr1; Pumag; Hydroxycarboxylic acid receptor 2; G-protein coupled receptor 109; G-protein coupled receptor 109A; G-protein coupled receptor HM74; Niacin receptor 1; Nicotinic acid receptor; Protein PUMA-G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR IFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAV DRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSIC YNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIIC FLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN FFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
Uniprot No.

Target Background

Function
Hydroxycarboxylic acid receptor 2 (HCAR2), also known as GPR109A, acts as a high-affinity receptor for both nicotinic acid (niacin) and (D)-beta-hydroxybutyrate. HCAR2 mediates increased adiponectin secretion and decreased lipolysis through G(i)-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect necessitates nicotinic acid doses significantly higher than those typically found in a standard diet. HCAR2 also mediates nicotinic acid-induced apoptosis in mature neutrophils. Receptor activation by nicotinic acid leads to reduced cAMP levels, potentially impacting the activity of cAMP-dependent protein kinase A and phosphorylation of target proteins, ultimately contributing to neutrophil apoptosis.
Gene References Into Functions
  1. HCA2 plays a critical role in host protection against pro-inflammatory insults. PMID: 28186140
  2. These findings demonstrate that GPR109A is functionally expressed in both human and murine islet beta-cells. PMID: 27570060
  3. This study reveals that the hypophagia of heat stress is independent of GPR109a, the hepatic vagus afferent nerve, and hepatic ketone body synthesis. PMID: 26936786
  4. Enhanced GPR109a expression in jejunal enterocytes of T2DM mice suggests a role for GPR109a in elevating intestinal glucose transport observed in diabetes. PMID: 26371038
  5. The expression of GPR109A in pancreatic beta cells is influenced not only by inflammation and glucose but also plays a protective role under inflammatory conditions. PMID: 26116596
  6. These results indicate that the PKC pathway and PDGFR/EGFR transactivation pathway play significant roles in HCA2-mediated Akt activation. PMID: 25375133
  7. Data suggest that GPR109a modulates niacin-induced pancreatic islet dysfunction through activation of the islet beta-cells. PMID: 25622782
  8. Data suggest that expression of Gpr109a is upregulated in adipocytes (intra-abdominal adipose tissue) and macrophages (peritoneal macrophages) during inflammation (models of gram-positive, gram-negative, viral, and fungal infections). PMID: 25320346
  9. HCAR2 activation by dietary or pharmacological means instructs Ly-6C(Lo) monocytes and/or macrophages to deliver a neuroprotective signal to the brain. PMID: 24845831
  10. data indicate that HCA mediates the therapeutic effects of DMF in EAE. PMID: 24691444
  11. GPR109A functions as a tumor suppressor in the mammary gland. PMID: 24371223
  12. role in mediating the beneficial effects of gut microbiota and dietary fiber in the colon PMID: 24412617
  13. chronic obesity reduces GPR109A and GPR81 expression in the adipose tissue, while acute in vitro LPS treatment increases expression of GPR109A in adipocytes and macrophages. PMID: 22842580
  14. 0.5-1% niacin in the daily diet activates the mouse GPR109A receptor. PMID: 21774590
  15. Data show that high levels of PUMA-G transcripts and protein were detected in all beta cells. PMID: 21441844
  16. Nicotinic acid inhibits progression of atherosclerosis in mice through its receptor GPR109A expressed by immune cells PMID: 21317532
  17. In conventional mice with normal bacterial colonization of the intestinal tract, GPR109A and SLC5A8 are expressed on the apical membrane of epithelial cells lining the ileum and colon. PMID: 20033346
  18. PUMA-G is highly expressed in adipose tissue and is a nicotinic acid receptor PMID: 12563315
  19. (D)-beta-hydroxybutyrate ((D)-beta-OHB) specifically activates PUMA-G/HM74a at concentrations observed in serum during fasting; (D)-beta-OHB inhibits mouse adipocyte lipolysis in a PUMA-G-dependent manner PMID: 15929991
  20. GPR109A mediates nicotinic acid-induced flushing, an effect which involves release of PGE(2) and PGD(2), most likely from immune cells of the skin PMID: 16322797
  21. Data show that many phenolic acids, including those from the hydroxybenzoic and hydroxycinnamic acid classes, can bind and activate GPR109A (HM74a/PUMA-G), the receptor for the antidyslipidemic agent nicotinic acid. PMID: 19136666
  22. GPR109A receptor plays a significant role in the dual regulation of adiponectin secretion and lipolysis PMID: 19141678
  23. studies demonstrated that GPR109A is expressed in the retina with its expression restricted to the retinal pigment epithelium, where it differentially polarizes to the basolateral membrane PMID: 19223991
  24. the ligand receptor pair 3-OH-octanoic acid/GPR109B mediates a negative feedback regulation of adipocyte lipolysis in humans but not in mice PMID: 19561068

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in lungs, spleen, heart, skeletal muscle and adipose tissue.

Q&A

Basic Research Questions

  • What is mouse HCAR2 and what is its significance in research?

    Mouse Hydroxycarboxylic acid receptor 2 (HCAR2, also known as GPR109A, PUMA-G, or Niacr1) is a class A G protein-coupled receptor that plays key roles in regulating lipolysis and free fatty acid formation. HCAR2 is highly expressed in multiple cell types, including adipocytes, vascular endothelium, immune cells, retinal pigmented cells, colonic epithelial cells, keratinocytes, and microglia . The receptor mediates downstream signaling primarily by coupling to the Gi/o family of G proteins .

    HCAR2 has gained significant research attention due to its involvement in numerous pathophysiological processes, making it an attractive target for studying cardiovascular, neoplastic, autoimmune, neurodegenerative, inflammatory, and metabolic diseases . Mouse models are particularly valuable for studying HCAR2 function as they allow for genetic manipulation and disease modeling.

  • What are the key structural features of mouse HCAR2?

    Mouse HCAR2 consists of 360 amino acids and shares significant structural homology with human HCAR2 . Recent cryo-EM structures have revealed critical structural features of HCAR2, including:

    • Three key residues (R111³·³⁶, S179⁴⁵·⁵², and Y284⁷·⁴³) that form the general pharmacophore features for HCAR2 agonists .

    • A unique extracellular architecture where ECL2 is closely clamped by ECL1 and ECL3, and compressed by the N-terminus from the top .

    • Three disulfide bonds (C100³·²⁵-C177⁴⁵·⁵⁰, C18ᴺ⁻ᵗᵉʳᵐ-C183⁵·³³, C19ᴺ⁻ᵗᵉʳᵐ-C266⁷·²⁵) that are crucial for receptor stability and function .

    The recombinant mouse HCAR2 protein typically includes a full-length sequence (1-360aa) and may be fused with tags (such as His) for purification and detection purposes .

  • How does mouse HCAR2 signaling function at the molecular level?

    HCAR2 signaling involves several key molecular mechanisms:

    • Upon activation, HCAR2 undergoes conformational changes characterized by an outward shift of the cytoplasmic side of TM6, which is consistent with the active state of class A GPCRs .

    • This conformational change permits insertion of the C-terminus of Gi protein .

    • The receptor primarily couples to Gi/o proteins, inhibiting adenylyl cyclase and reducing cAMP levels .

    • Distinct domains within the C-terminal tail of HCAR2 play crucial roles in:

      • Receptor export to the cell surface

      • Constitutive activity

      • Desensitization

      • Phosphorylation

      • Internalization

    Notably, a sequence from residues 329 to 343 in the C-terminal tail plays a critical role in maintaining HCAR2 in an inactive conformation .

Intermediate Research Questions

  • What experimental approaches are recommended for studying recombinant mouse HCAR2?

    Several effective experimental approaches for studying recombinant mouse HCAR2 include:

    • Expression systems: E. coli expression systems have been successfully used to produce recombinant full-length mouse HCAR2 with N-terminal His tags .

    • Functional assays:

      • cAMP accumulation assays to assess Gi-coupled signaling

      • CRE-driven luciferase activity assays for receptor functionality

      • ERK1/2 activation assays to monitor downstream signaling

      • Calcium mobilization using Fura-2AM for measuring intracellular calcium responses

    • Localization studies:

      • Confocal microscopy with membrane markers such as DiI

      • ELISA analyses to quantify cell surface expression versus total cellular expression

    • Reporter systems:

      • The HCAR2 mRFP (Gpr109a mRFP) reporter mouse line, where the HCAR2 locus directs the expression of monomeric red fluorescent protein, provides a valuable tool for visualizing receptor expression in vivo .

  • How can researchers effectively generate and validate HCAR2 knockout mouse models?

    Generating and validating HCAR2 knockout models requires careful methodology:

    • Global knockout: HCAR2⁻/⁻ (Hcar2⁻/⁻) mice have been widely used to study the receptor's function. These knockout mice show no overt phenotype if unchallenged but display significant differences in disease models .

    • Conditional knockout: Cell-specific knockout models (such as HCAR2ᶠˡᵒˣᵖᶜˣᶜ³ʳ¹ ᶜʳᵉ) can be generated to study HCAR2 function in specific cell types, such as microglia .

    • Validation methods:

      • RT-PCR to confirm absence of HCAR2 mRNA expression

      • Western blotting to verify protein absence

      • Functional assays to demonstrate loss of HCAR2-mediated responses

      • Testing with HCAR2 agonists (like niacin or β-hydroxybutyrate) to confirm lack of response in knockout models

    • Experimental design considerations:

      • Include appropriate littermate controls

      • Consider that compensatory mechanisms may develop in global knockout models

      • For microglia-specific studies, depletion using CSF1R antagonists (e.g., PLX5622) can help validate HCAR2's role specifically in these cells

  • What are the most effective agonists for studying mouse HCAR2 function?

    Several agonists have been characterized for studying mouse HCAR2 function, each with specific properties:

    AgonistDescriptionApplicationFlush Response
    NiacinEndogenous ligand, high affinityGenerally used at 10-25μM in vitroAssociated with flushing side effect
    β-hydroxybutyrate (BHB)Endogenous ketone bodyUsed at 3mg/mL in drinking water for in vivo studiesLimited flushing
    AcipimoxSynthetic drugSimilar binding mode to niacinAssociated with flushing
    MK-6892Highly subtype-specific agonistShows extended binding pocket relative to other agonistsLimited flushing
    GSK256073Synthetic agonistHigh potencyLimited flushing
    Dimethyl fumarate (DMF)Active metabolite: monomethyl fumarate (MMF)Used for therapeutic studies in disease modelsLimited flushing

    Recent structural studies have revealed that despite differences in flushing side effects, both "flushing" and "non-flushing" agonists exhibit similar binding modes, suggesting that the mechanisms behind these differential effects may involve factors beyond simple receptor binding .

Advanced Research Questions

  • How does HCAR2 regulate microglial responses in neurodegenerative disease models?

    HCAR2 plays a significant role in regulating microglial responses in neurodegenerative diseases through several mechanisms:

    • Expression pattern: HCAR2 is robustly induced in microglia in response to amyloid pathology in Alzheimer's disease (AD) models. Transcriptomic data shows significantly increased HCAR2 expression in microglia associated with neuritic Aβ plaques .

    • Knockout effects: Genetic inactivation of HCAR2 in 5xFAD mice (AD model) impairs microglial response to amyloid pathology, resulting in:

      • Exacerbation of plaque burden

      • Increased neuronal pathology

      • Cognitive impairment

    • Activation benefits: Activation of HCAR2 with approved formulations of niacin (Niaspan) stimulates a protective microglial response leading to:

      • Decreased plaque burden

      • Reduced neuronal loss

      • Improved working memory

    • Signaling mechanisms: In microglia, HCAR2 activation can inhibit NF-κB phosphorylation and modulate inflammatory cytokine production. Some agonists (like MMF) operate through a calcium-dependent signaling pathway, while others may utilize AMPK/Sirt1-independent mechanisms .

    For experimental design, researchers should consider combining transcriptomic analysis of sorted microglia, immunohistochemistry, behavioral testing, and pharmacological interventions with HCAR2 agonists to comprehensively assess microglial responses.

  • What are the methodological challenges in studying HCAR2-mediated signaling and how can they be addressed?

    Several methodological challenges exist in studying HCAR2-mediated signaling:

    • Ligand selectivity: HCAR2 shares significant homology with other hydroxycarboxylic acid receptors, making ligand selectivity challenging. Recent structural insights have identified key residues that determine ligand selectivity between HCAR2 and HCAR3 . Researchers should carefully validate receptor specificity using knockout controls and selective agonists.

    • Receptor desensitization: HCAR2 undergoes rapid desensitization and internalization following activation. Mutants with C-terminal deletions between Arg315 to Ser328 or alanine substitutions for Ser326, Thr327, and Ser328 show deficiencies in arrestin3 binding, receptor internalization, phosphorylation, and desensitization . Consider the timing of measurements in signaling assays to account for desensitization kinetics.

    • Cell-type specific effects: HCAR2 activation can produce different outcomes in different cell types. For example, MMF signaling through HCAR2 can involve calcium signaling in some cells while utilizing NF-κB inhibition in others . When designing experiments, use cell-type specific knockout models or isolated primary cells to account for these differences.

    • Constitutive activity: The C-terminal region (residues 329-343) plays a crucial role in maintaining HCAR2 in an inactive conformation. Deletion of this region results in constitutive activity . Careful consideration of baseline activity is important when interpreting experimental results.

  • How can HCAR2 be effectively targeted in inflammatory and neurodegenerative disease models?

    Effectively targeting HCAR2 in disease models requires strategic approaches:

    • Pharmacological targeting:

      • For Alzheimer's disease: FDA-approved niacin formulations (Niaspan) stimulate a protective microglial response that reduces plaque burden and improves memory .

      • For Parkinson's disease: Nicotinic acid (NA) administration (3mg/mL in drinking water) activates HCAR2 to regulate microglial responses and alleviate neuroinflammation .

      • For multiple sclerosis: Dimethyl fumarate (DMF) mediates protective effects through HCAR2, reducing neurological deficit and immune cell infiltration .

    • Experimental design considerations:

      • Duration: Long-term studies (4+ weeks) are necessary to observe meaningful effects on disease progression .

      • Route of administration: Oral administration (drinking water or gavage) is commonly used for compounds like niacin (30mg/kg, twice daily) .

      • Assessment parameters should include:

        • Behavioral tests (open field, pole-climbing, rotor experiments)

        • Histopathological evaluation

        • Inflammatory marker analysis

        • Cell-specific responses

    • Translational potential:

      • Research suggests activation of HCAR2 has therapeutic potential across multiple neurodegenerative diseases .

      • The presence of already-approved HCAR2 agonists (niacin, DMF) facilitates potential clinical translation.

  • What role does HCAR2 play in retinal inflammation and how can it be studied in mouse models?

    HCAR2 plays a significant role in regulating retinal inflammation and immunity:

    • Expression pattern: HCAR2 is expressed in retinal pigment epithelial (RPE) cells, microglia, and endothelial cells in the retina .

    • Functional significance:

      • HCAR2 knockout mice exhibit progressive anomalies in retinal morphology and function affecting the entire retina .

      • Gene expression and protein interactome analyses of knockout mice reveal differences consistent with increased immune reactivity and infiltration of bone-marrow derived immune cells .

    • Therapeutic potential:

      • Targeting HCAR2 with β-hydroxybutyrate limits immune cell activation, infiltration, and related inflammation in wild-type mouse retinas in models of endotoxin-induced inflammation .

    • Methodological approaches:

      • Functional assessment: Electroretinography (ERG) to evaluate retinal function longitudinally

      • Imaging: Fundoscopic imaging, spectral domain-optical coherence tomography (OCT), and fluorescein angiography

      • Histological analysis: Post-mortem histological analyses to evaluate retinal health

      • Molecular profiling: Gene microarray, RT-qPCR studies, ingenuity analyses, and proteome pathway mapping

      • Immune cell analysis: Leukostasis and flow cytometric assays to demonstrate the impact of HCAR2 on pro-inflammatory immune cell trafficking in retina

    These findings highlight HCAR2 as a major regulator of retinal immune responses under normal conditions and as a high-potential therapeutic target for modulating inflammatory responses in retinal diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.