Recombinant Mouse Immunoglobulin superfamily DCC subclass member 3 (Igdcc3)

Shipped with Ice Packs
In Stock

Description

Introduction to Igdcc3

Immunoglobulin Superfamily DCC Subclass Member 3 (Igdcc3) is a member of the immunoglobulin superfamily proteins and specifically belongs to the DCC (Deleted in Colorectal Cancer) subclass. In mice, the Igdcc3 gene is officially designated as "immunoglobulin superfamily, DCC subclass, member 3" . The protein is encoded by a gene located on mouse chromosome 9 and is characterized by its immunoglobulin-like domains, which are common structural features in many cell surface proteins involved in cell adhesion, receptor signaling, and molecular recognition processes.

Igdcc3 has been identified as a protein of interest in several biological contexts, particularly in cerebrovascular research where alterations in its expression levels have been associated with pathological vascular remodeling. As a member of the immunoglobulin superfamily, it likely participates in cell-cell interactions and signaling pathways that influence tissue structure and function.

Role in Vascular Biology

Recent research has implicated Igdcc3 in vascular biology, particularly in processes related to vascular remodeling. In a proteome profiling study of brain vessels in a mouse model overexpressing transforming growth factor beta (TGFβ) in the brain, Igdcc3 was identified among proteins showing significantly altered levels compared to wild-type mice . Specifically, Igdcc3 showed increased expression in the cerebral arteries of these TGF mice, which are characterized by cerebrovascular pathology similar to that seen in vascular cognitive impairment and dementia (VCID) .

The study identified Igdcc3 as one of 11 proteins (out of 20 with significantly altered levels) known to influence vascular remodeling. Other proteins in this group included Dll3, Adgrg2, Krt24, Ptprd, Ptprn2, Rngtt, Rp1l1, Tacstd2, Zfyve26, and Zfyve27 . This association suggests that Igdcc3 may play a role in the structural modifications of blood vessels that occur during both normal development and pathological conditions.

Association with Cerebrovascular Pathology

The TGF mouse model used in the aforementioned study recapitulates several features of cerebrovascular pathology observed in VCID, including thickened vascular walls, impaired dilatory function, cerebral hypoperfusion, neurovascular uncoupling, and cerebral microhemorrhages . The observation that Igdcc3 levels are altered in this model suggests a potential involvement in the pathological processes underlying these vascular abnormalities.

Furthermore, the study confirmed the presence of Igdcc3 in depleted human plasma samples, indicating that this protein may be detectable in the circulation and potentially serve as a biomarker for cerebrovascular conditions . This finding opens up possibilities for non-invasive diagnostic approaches based on the detection of Igdcc3 or its fragments in blood samples.

Recombinant Forms and Production

For research applications, Recombinant Mouse IGDCC3 Protein is commercially available with various tags to facilitate purification and detection. One such product is Recombinant Mouse IGDCC3 Protein with His (Fc)-Avi tag, which is expressed and purified from HEK293 cells . HEK293 cells are a widely used mammalian expression system that generally provides proper folding and post-translational modifications for mammalian proteins.

Several commercial variants of recombinant mouse Igdcc3 are available, including:

  • Recombinant Mouse IGDCC3 Protein (untagged)

  • Recombinant Mouse IGDCC3 Protein, His (Fc)-Avi-tagged

  • Recombinant Full Length Mouse Immunoglobulin Superfamily Dcc Subclass Member 3 (Igdcc3) Protein, His-Tagged

Additionally, human variants such as Recombinant Human IGDCC3, His-tagged are also commercially available, facilitating comparative studies between mouse and human forms of the protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Igdcc3; Punc; Immunoglobulin superfamily DCC subclass member 3; Putative neuronal cell adhesion molecule
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-813
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Igdcc3
Target Protein Sequence
LGHSAELAFSVEPNDDIANPGQPIVLGCKVEGTPPVQVSWRKNGAELPEGTHTTLLANGS LLIHHFRLEQGGSPSDEGDYECVAQNRFGLLVSRKARLQAATMSDFHVHPQAVTGEEGGV ARFQCQIHGLPKPLITWEKNRVPIDTDDERYTLLPKGVLQITGLRAEDSGIFHCVASNIA SVRVSHGARLTVSGSGSGTYKEPTILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLD GRPIGVEGIQVLGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQH PQSISRPAGTTAMFTCQAQGEPPPHVTWLKNGQVLGAGGHVRLKNNNSTLSISGVGPEDE AIYQCVAENIAGSSQASARLTVLWAEGLPGPPRNVRAVSVSSTEVRVSWSEPLAHTKEII GYVLHIRKAADSPKLEYQEAVSKSTFQHLVRDLEPSTAYSFYIKAYTPRGASLASVPTLA STLGEAPVPPPLSVRLLGSSSLQLLWKPWPRLAQHNGGFKLFYRPVSATSFTGPILLPGT VSSYNLSQLDPSTVYEVKLLAYNQHGDGNATVRFVSLKGASERTALTPPCDCRKEDVTNH TSTTGIVIGIHIGVTCIIFCVLFLLFGQRGRVLLCKDVENQLSPPQGPRSQRDPGILALN GLSRGEGGQLSRDEKPVDAKELEQLFPTAGSAAQPGSTPTDPAAPAPCEETQLSMVQLQG FNLVAGRTTEATSPCAGPGPVPAPQDIGPVPLSEGQTQPPAVAAPQ
Uniprot No.

Target Background

Database Links
Protein Families
Immunoglobulin superfamily, DCC family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in cerebellum, kidney, heart, lung, skeletal muscle and spleen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.