Recombinant Mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Mcl1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Mcl1Induced myeloid leukemia cell differentiation protein Mcl-1 homolog; Bcl-2-related protein EAT/mcl1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Uniprot No.

Target Background

Function
MCL1 is involved in regulating apoptosis versus cell survival and maintaining cell viability, but not proliferation. It exerts its effects through interactions with various apoptosis regulators. Isoform 2 exhibits anti-apoptotic activity.
Gene References Into Functions
  1. The VCP-UBXD1 complex degrades the outer membrane protein MCL1, a process accelerated by mutant Huntingtin. PMID: 27913212
  2. miR-29b suppresses proliferation and promotes apoptosis in pulmonary artery smooth muscle cells, potentially through Mcl-1 and CCND2 inhibition. PMID: 29662889
  3. Chemotherapeutic drugs showed no significant adverse effects on Mcl-1(+/-) heterozygous mice, which have approximately 50% reduced MCL-1 protein levels. PMID: 28800129
  4. Analysis of how a hydrophobic staple induces unexpected structural rearrangement in Mcl-1 upon binding. PMID: 29339518
  5. Mcl-1 is a disease-specific target of Cdk5, associating with Cdk5 under basal conditions but not regulated by it. PMID: 28751497
  6. A novel link between B cell receptor affinity and BAFF-R signaling towards Mcl-1 is identified, elucidating a key molecular pathway in early B cell activation selection. PMID: 27762293
  7. Despite normal Mcl-1 protein levels in Mcl1-flox-del homozygous animals, males exhibited infertility. PMID: 27906183
  8. Cell survival depends on the quantitative contribution of multiple anti-apoptotic proteins (BCL2, Mcl1, and BCL2A1), not a single protein. PMID: 28362427
  9. Epstein-Barr virus-infected cells exhibit unique B cell survival mechanisms reliant on MCL-1 mitochondrial localization and BFL-1 transcription regulation by EBNA3A. PMID: 28425914
  10. Mcl-1 overexpression significantly exacerbates the lpr phenotype, leading to more severe splenomegaly and lymphadenopathy in Mcl-1tg/lpr mice. PMID: 27813531
  11. Endothelial cell-specific Mcl1 deletion caused dose-dependent increases in endothelial cell apoptosis and reduced vessel density. PMID: 26943318
  12. MCL-1 expression is a crucial biomarker for thymic epithelial cell (TEC) survival. PMID: 28972012
  13. MCL-1 is a key pro-survival protein preventing beta-cell death, and its downregulation by pro-inflammatory cytokines is crucial. PMID: 28667119
  14. Mcl-1 is dispensable for apoptosis regulation during infection with large DNA viruses, unlike Bcl-XL. PMID: 27537523
  15. BCL-XL, BCL-2, and MCL-1 are important for B cell survival at different developmental stages. PMID: 27560714
  16. miR-32/MCL-1 pathway members are key early genetic events driving melanoma progression. PMID: 27846237
  17. GSK3B-MCL1 signaling in axonal autophagy is important for Wallerian degeneration. PMID: 28053206
  18. Mcl-1 downregulation significantly increases peritoneal macrophage apoptosis, primarily mediated by the MAPK pathway. PMID: 26876933
  19. MCL1 plays a key role in Leydig cell steroidogenesis and may offer insights into metabolic regulation in these cells. PMID: 26995740
  20. While single Mcl-1 allele loss doesn't significantly affect normal B lymphoid cell survival, it markedly impairs survival of c-myc overexpressing B cell progenitors. PMID: 26947081
  21. MCL-1 loss in early B-lymphoid progenitors delayed MYC-driven lymphomagenesis. PMID: 26962682
  22. High Mcl-1 levels enhance mTOR phosphorylation and augment the differentiation of effector and memory CD8 T cells. PMID: 26855329
  23. Leishmania donovani utilizes host MCL-1 to prevent macrophage apoptosis during antiparasitic treatment, contributing to visceral leishmaniasis progression. PMID: 26670606
  24. Soluble factors from multiple myeloma (MM) cells induce myeloid-derived suppressor cells (MDSC) through Mcl-1 upregulation. PMID: 25871384
  25. Inverse coregulation between BECN1 and MCL1 significantly impacts their opposing roles in tumorigenesis. PMID: 25837021
  26. A non-redundant pathway links IL-15 to Mcl1 in maintaining NK cells and innate immune responses. PMID: 25119382
  27. MCL-1 is essential for maintaining the postnatal primordial follicle pool, follicle survival, and oocyte mitochondrial function. PMID: 25950485
  28. Tax interacts with and activates TRAF6, triggering its mitochondrial localization and conjugation of MCL-1 lysine residues with ubiquitin chains. PMID: 25340740
  29. Mir155 deletion prevents Fas-induced hepatocyte apoptosis and liver injury by upregulating Mcl1. PMID: 25794705
  30. Beclin 1 and Mcl-1 exhibit inverse co-regulation, functionally counteracting each other in cancer. PMID: 25472497
  31. miR-29a is involved in ulcerative colitis pathogenesis by regulating intestinal epithelial apoptosis via Mcl-1. PMID: 25674218
  32. MCL1, unlike BAK, forms stable heterodimers with cBID, modulated by membrane cardiolipin content and curvature. PMID: 25987560
  33. MCL1 exhibits lipid-dependent bimodal membrane activity. PMID: 25314294
  34. PUMA and MCL-1 antagonism is the primary control axis for hematopoietic stem cell survival. PMID: 25847014
  35. Cafestol overcomes ABT-737 resistance in Mcl-1-overexpressing renal carcinoma cells by downregulating Mcl-1 and upregulating Bim. PMID: 25375379
  36. Mcl-1 is essential for mammopoiesis; EGF triggers Mcl-1 translation to ensure alveolar cell survival. PMID: 25730472
  37. Granulocytic subset deletion doesn't alter tumor growth or incidence in vivo. PMID: 25500368
  38. Only MCL-1, not BCL-XL, is critical for thymic lymphoma development and growth elicited by p53 loss. PMID: 25368374
  39. Mcl-1 downregulation exhibits anti-inflammatory, pro-resolution effects and enhances bacterial lung clearance. PMID: 24280938
  40. Study of pro-apoptotic Bim and anti-apoptotic Mcl-1. PMID: 24825007
  41. Mcl-1 positively regulates cell viability and negatively regulates osteoclast bone-resorbing activity. PMID: 24096094
  42. Noxa targets the mitochondrial membrane, neutralizing Mcl-1 via its C-terminal BH3 domain. PMID: 23733106
  43. Mcl-1 deficient fibroblasts reliant on Bcl-XL and Bax/Bak deficient fibroblasts support mechanism-based apoptosis induction. PMID: 23767404
  44. Mouse Mcl1, a pro-survival Bcl2 relative, reduces stress-induced apoptosis, causes male sterility, and promotes tumorigenesis. PMID: 24363325
  45. Notch1 inhibits stimulated macrophage apoptosis by directly controlling the mcl1 promoter. PMID: 23872918
  46. Mcl-1 is crucial for effector T-cell responses by counteracting pro-apoptotic molecules beyond Bim. PMID: 23558951
  47. Parkin dysfunction (PARK2 mutation) may lead to dopaminergic neuron death via unregulated SCF(Fbw7beta)-mediated Mcl-1 proteolysis. PMID: 23858059
  48. Metabolic control of Mcl-1 expression is a key event in caloric restriction's effects on sensitizing lymphoma cells to apoptosis. PMID: 23966420
  49. Antiapoptotic Mcl-1 is essential for Foxp3 regulatory T cell survival and niche-filling capacity. PMID: 23852275
  50. In the absence of p27(Kip1), Mcl1 fails to induce neural progenitor cell (NPC) cell cycle exit, highlighting p27(Kip1)'s role in Mcl1-mediated NPC terminal mitosis. PMID: 23824576
Database Links

KEGG: mmu:17210

STRING: 10090.ENSMUSP00000044048

UniGene: Mm.1639

Protein Families
Bcl-2 family
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Mitochondrion. Nucleus, nucleoplasm. Note=Cytoplasmic, associated with mitochondria.

Q&A

What is mouse Mcl-1 and how does it function in cellular processes?

Mouse Mcl-1 (Myeloid cell leukemia-1) is a member of the BCL-2 family of proteins that primarily functions as an anti-apoptotic regulator. Similar to human MCL-1, the mouse homolog contains conserved BCL-2 homology (BH) domains and plays critical roles in cell survival by binding to and sequestering pro-apoptotic BH3-only proteins like BIM and BAK, thereby preventing apoptosis initiation.

Mouse Mcl-1 undergoes alternative splicing to generate multiple isoforms with distinct functions. The longest isoform enhances cell survival by inhibiting apoptosis, while shorter isoforms can actively promote apoptotic cell death. This functional dichotomy makes Mcl-1 a particularly complex target in experimental systems .

How does mouse Mcl-1 expression change in response to cellular stress?

Mouse Mcl-1 expression is highly responsive to various cellular stressors. Similar to human MCL-1, expression increases upon exposure to DNA damaging agents including ionizing radiation, ultraviolet radiation, and alkylating drugs. This upregulation occurs alongside changes in other apoptotic regulators such as increases in GADD45 and Bax and decreases in BCL-2, suggesting a coordinated stress response .

In experimental mouse models, researchers should carefully monitor Mcl-1 expression kinetics following the introduction of stressors, as the protein has a relatively short half-life and its levels can fluctuate rapidly in response to changing cellular conditions.

What are the key structural features of recombinant mouse Mcl-1 that affect its experimental applications?

Recombinant mouse Mcl-1 contains several structural features critical for its function that researchers must consider:

  • BH domains: Four conserved BH domains (BH1-BH4) with the BH3 domain being particularly critical for protein-protein interactions

  • Hydrophobic binding groove: Contains four hydrophobic pockets (P1-P4) that serve as binding sites for BH3-only proteins and small molecule inhibitors

  • PEST sequences: Regions rich in proline (P), glutamic acid (E), serine (S), and threonine (T) that regulate protein stability

  • Transmembrane domain: C-terminal region that facilitates localization to mitochondrial membranes

These structural elements should be preserved in recombinant preparations to ensure proper folding and functionality in experimental applications .

What are optimal expression systems for producing functional recombinant mouse Mcl-1?

The selection of expression systems for recombinant mouse Mcl-1 should be guided by experimental requirements:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapidLimited post-translational modifications, potential inclusion body formationStructural studies, binding assays
Mammalian (HEK293)Proper folding, native-like modificationsLower yield, higher costFunctional studies, cell-based assays
Insect cellsIntermediate yield, good foldingModerate cost, different glycosylation patternsCrystallography, biochemical assays

For most applications requiring highly functional protein, mammalian expression systems are preferred to ensure proper folding and post-translational modifications of mouse Mcl-1 .

How can researchers effectively validate the functionality of recombinant mouse Mcl-1?

Functional validation of recombinant mouse Mcl-1 should include multiple complementary approaches:

  • Binding assays: Fluorescence polarization assays measuring the interaction between recombinant Mcl-1 and BH3 peptides derived from interacting partners (e.g., BIM, NOXA)

  • Thermal shift assays: To confirm proper folding and stability of the recombinant protein

  • Cell-based functional assays: Evaluating the ability of recombinant Mcl-1 to rescue Mcl-1-deficient cells from apoptosis

  • Competitive displacement assays: Testing the ability of known Mcl-1 inhibitors to disrupt interactions between recombinant Mcl-1 and its binding partners

Researchers should ensure that the recombinant protein maintains its native hydrophobic binding groove structure, which is essential for its anti-apoptotic function .

What experimental approaches can determine the binding specificity of mouse Mcl-1 with BH3-only proteins?

Several approaches can effectively characterize Mcl-1 binding specificity:

  • Isothermal titration calorimetry (ITC): Provides direct measurement of binding affinities (Kd values) and thermodynamic parameters of Mcl-1 interactions with various BH3-only proteins

  • Surface plasmon resonance (SPR): Enables real-time analysis of binding kinetics (kon and koff rates)

  • Co-immunoprecipitation assays: Confirms interactions in more complex cellular contexts

  • Alanine scanning mutagenesis: Identifies critical amino acid residues involved in specific binding interactions

  • X-ray crystallography: Provides detailed structural information about binding interfaces

When designing these experiments, researchers should consider that the hydrophobic pockets P2 and P3 in the Mcl-1 BH3 groove have the most potential to bind Mcl-1–binding peptides, with P2 being relatively larger than P3 .

How is mouse Mcl-1 implicated in hematological malignancy models?

Mouse Mcl-1 plays critical roles in hematological malignancy models that parallel human disease:

  • Lymphoma models: High levels of Mcl-1 expression are required for B-lymphoma cell survival and correlate with high-grade lymphoma, suggesting an association between Mcl-1 overexpression and progressive disease

  • Transgenic models: Mice overexpressing Mcl-1 show increased incidence of B-cell lymphoma, directly demonstrating its oncogenic potential

  • Multiple myeloma models: Similar to human multiple myeloma, mouse models show Mcl-1 dependency for survival, making it a promising therapeutic target

  • Leukemia models: Knockdown of Mcl-1 in mouse xenograft models decreases cancer cell proliferation rates compared to controls

These findings establish mouse models as valuable tools for studying Mcl-1's role in hematological malignancies and testing targeted therapies .

What methodologies effectively measure mouse Mcl-1 dependency in cancer models?

Researchers can assess Mcl-1 dependency in mouse cancer models through:

  • BH3 profiling: Measures mitochondrial response to BH3 peptides to determine cellular dependency on specific anti-apoptotic proteins

  • RNA interference approaches: siRNA or shRNA knockdown of Mcl-1 with measurement of subsequent apoptotic responses

  • CRISPR/Cas9 knockout studies: Complete gene deletion to assess survival dependency

  • Small molecule inhibitor sensitivity: Dose-response studies with selective Mcl-1 inhibitors like A-1210477

  • Dynamic BH3 profiling: Measures changes in mitochondrial priming following drug treatment

These approaches should be used in combination to comprehensively characterize Mcl-1 dependency in experimental models .

How can mouse models be used to evaluate the efficacy and toxicity profiles of MCL-1 inhibitors?

Mouse models provide critical platforms for evaluating MCL-1 inhibitors:

Model TypeApplicationKey MeasurementsSpecial Considerations
Xenograft modelsInitial efficacy screeningTumor volume, survivalLimited immune context
Syngeneic modelsImmune context assessmentTumor growth, immune infiltrationBetter recapitulates tumor microenvironment
PDX modelsTranslation to human diseaseResponse rates, biomarker studiesHigher clinical relevance
Transgenic modelsLong-term toxicityCardiac function, multi-organ effectsImportant for safety assessment

Researchers must monitor cardiac function closely, as cardiac-specific deletion of MCL-1 in mice leads to mitochondrial dysfunction, impaired autophagy, hypertrophy, and cardiomyopathy with distorted ultrastructure of disorganized sarcomeres and swollen mitochondria. This cardiotoxicity represents a major challenge in MCL-1 inhibitor development .

What are the optimal strategies for designing mouse Mcl-1 inhibitors with improved selectivity?

Designing selective mouse Mcl-1 inhibitors requires consideration of several structural features:

  • Target the unique hydrophobic binding pockets: Focus on the P2 and P3 pockets which show the greatest potential for selective binding. The P2 hydrophobic groove is relatively larger than P3 and can accommodate ligands with larger structural moieties.

  • Exploit the Arg263 residue: This important hot spot forms a hydrogen bond (salt bridge) with effective MCL-1 inhibitors. Crystal structure analysis shows this salt bridge formation is essential for efficacy.

  • Incorporate indole moiety: This provides structural privilege for MCL-1 inhibitors.

  • Focus on four hydrophobic pockets (P1-P4): These are critical hot spots required for peptide binding.

  • Structure-guided optimization: Use nuclear magnetic resonance, X-ray crystallography, and alanine mutagenesis studies to identify critical binding determinants.

These approaches have led to the development of several clinical-stage MCL-1 inhibitors with improved selectivity profiles .

How can researchers overcome resistance mechanisms to Mcl-1 inhibition in experimental models?

To address resistance to Mcl-1 inhibition, researchers should implement these strategies:

  • Combination approaches: Test MCL-1 inhibitors with BCL-2 inhibitors like venetoclax, especially in models showing dual or heterogeneous dependency on BCL-2/MCL-1.

  • Sequential treatment strategies: Explore approaches that modulate MCL-1 levels before applying other therapies (e.g., ibrutinib treatment followed by venetoclax has shown success in certain contexts).

  • Targeting multiple nodes in the apoptotic pathway: Consider combinations with agents that upregulate pro-apoptotic proteins.

  • Transient inhibition strategies: Brief, potent inhibition may maintain efficacy while reducing toxicity concerns.

  • Biomarker-guided approaches: Identify markers of MCL-1 dependency to better select responsive models.

These strategies are particularly relevant in contexts like AML, which shows dual or heterogeneous dependency on BCL-2/MCL-1, where MCL-1 appears to be a major driver of resistance to venetoclax .

What experimental approaches best characterize the molecular mechanism of mouse Mcl-1 inhibitors?

Comprehensive characterization of Mcl-1 inhibitor mechanisms should include:

  • Target engagement studies: Cellular thermal shift assays (CETSA) to confirm direct binding to Mcl-1 in intact cells

  • Protein-protein interaction disruption assays: Bioluminescence resonance energy transfer (BRET) or split-luciferase approaches to measure disruption of Mcl-1:BH3-only protein interactions

  • BH3 profiling: To confirm mechanism-based changes in mitochondrial priming

  • Molecular dynamic simulations: To understand binding kinetics and conformational changes

  • Co-crystal structures: To visualize the precise molecular interactions between inhibitors and the Mcl-1 binding groove

These approaches help distinguish direct inhibitors from compounds that may reduce Mcl-1 levels through other mechanisms like transcriptional or translational inhibition, or enhanced protein degradation .

What are common technical challenges when working with recombinant mouse Mcl-1 and how can they be overcome?

ChallengeCauseSolution
Poor protein solubilityHydrophobic binding pocket, improper foldingUse solubility tags (SUMO, GST), optimize buffer conditions, consider co-expression with stabilizing partners
Low protein stabilityShort half-life, susceptibility to proteasesInclude protease inhibitors, optimize storage conditions, express more stable constructs (e.g., core domain only)
Inactive proteinImproper folding, loss of binding groove structureValidate using binding assays with known partners, optimize refolding protocols if using E. coli
Variable binding affinitiesDifferent experimental conditionsStandardize buffer conditions, control temperature, include appropriate positive controls
Inconsistent results across experimentsLot-to-lot variabilityImplement rigorous quality control, validate each batch with functional assays

Careful optimization of expression, purification, and storage conditions is essential for consistent experimental results with recombinant mouse Mcl-1 .

How can researchers distinguish between effects of different mouse Mcl-1 isoforms in experimental systems?

To distinguish between effects of different Mcl-1 isoforms:

  • Isoform-specific antibodies: Use antibodies that specifically recognize different Mcl-1 isoforms for Western blotting and immunoprecipitation

  • RT-PCR with isoform-specific primers: Design primers spanning exon junctions unique to each isoform

  • Expression constructs: Generate expression vectors containing individual isoforms for comparative functional studies

  • CRISPR/Cas9 editing: Design guide RNAs that selectively target specific isoforms

  • Proteomics approach: Use mass spectrometry to identify and quantify specific isoforms in complex samples

Remember that isoform 1 (the longest) enhances cell survival by inhibiting apoptosis, while shorter isoforms (isoform 2 and isoform 3) promote apoptosis and are death-inducing, making careful isoform discrimination crucial for interpreting experimental results .

What considerations are important when translating findings from mouse Mcl-1 studies to human applications?

When translating mouse Mcl-1 findings to human applications, researchers should consider:

  • Species-specific differences: While generally conserved, there may be differences in regulation, post-translational modifications, and binding affinities between mouse and human Mcl-1

  • Context-dependent functions: The role of Mcl-1 may vary between tissue types and disease states

  • Differential inhibitor responses: Mouse models may respond differently to MCL-1 inhibitors than human cells due to subtle structural differences

  • Toxicity profiles: Careful assessment of on-target toxicities in mice (particularly cardiotoxicity) is essential before human translation

  • Pharmacokinetic differences: Mouse metabolism may differ significantly from humans, affecting drug exposure and efficacy

These considerations highlight why findings from single mouse models should be validated across multiple experimental systems before clinical translation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.