Recombinant Mouse Insulin-induced gene 2 protein (Insig2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify your needs when placing the order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Insig2; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Insig2
Target Protein Sequence
MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVITSIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Uniprot No.

Target Background

Function
Insulin-induced gene 2 (Insig2) is an oxysterol-binding protein that mediates feedback control of cholesterol synthesis. It regulates both the endoplasmic reticulum to Golgi transport of SCAP and the degradation of HMGCR. Insig2 acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the endoplasmic reticulum. This action effectively blocks the processing of sterol regulatory element-binding proteins (SREBPs), specifically SREBF1/SREBP1 and SREBF2/SREBP2.

Insig2 binds oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, regulating its interaction with SCAP and the retention of the SCAP-SREBP complex in the endoplasmic reticulum. In the presence of oxysterol, Insig2 interacts with SCAP, preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi.

Sterol deprivation or phosphorylation by PCK1 reduces oxysterol binding, disrupting the interaction between Insig2 and SCAP. This disruption promotes Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2.

Insig2 also regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligase RNF139.
Gene References Into Functions
  1. Intracellular biosynthesis of lipids and cholesterol by Scap and Insig in mesenchymal cells regulates long bone growth and chondrocyte homeostasis. PMID: 29899135
  2. INSIG2 is a negative regulator of SREBP, and acute glucocorticoid treatment decreased active SREBP during refeeding or in livers of Ob/Ob mice, both systems of elevated SREBP-1c-driven lipogenesis. PMID: 27568546
  3. These results indicate that HIF-mediated induction of Insig-2 and degradation of HMGCR are physiologically relevant events that guard against wasteful oxygen consumption and inappropriate cell growth during hypoxia. PMID: 28416613
  4. the essential role of Insig1,2 proteins in the sterol homeostasis of enterocytes. PMID: 24337570
  5. Insig deficiency in skin causes accumulation of cholesterol precursors, and this impairs normal hair development PMID: 20090767
  6. Data show that REV-ERBalpha participates in the circadian modulation of SREBP activity, and the expression of SREBP target genes involved in cholesterol and lipid metabolism via the cyclic transcription of Insig2. PMID: 19721697
  7. Liver-specific mRNA for Insig-2 down-regulated by insulin: implications for fatty acid synthesis. PMID: 12624180
  8. a vitamin D response element in the murine Insig-2 promoter may have a role in the differentiation of 3T3-L1 preadipocytes PMID: 15528275
  9. Results define Insig proteins 1 and 2 as essential elements of the feedback inhibition system of cholesterol synthesis in mouse liver. PMID: 16100574
  10. Insig2 identified as a strong candidate susceptibility gene for total plasma cholesterol levels in inbred mice strains PMID: 16126366
  11. Treatment of pregnant mice with the HMG-CoA reductase inhibitor lovastatin reduced sterol synthesis in Insig2-knockout embryos and reduced the pre-cholesterol intermediates ameliorating the clefting. PMID: 16955138
  12. A critical gene involved in cholesterol homeostasis, Insig-2, was induced when mice or cultured cells were treated with FXRalpha agonists or infected with constitutively active FXRalpha. PMID: 17440045
  13. Peroxisome deficiency causes a complex phenotype because of hepatic SREBP-1c,-2/Insig-2a,b dysregulation associated with endoplasmic reticulum stress PMID: 19110480
  14. Silibinin inhibits adipocyte differentiation through a potential up-regulation of insig-1 and insig-2 at an early phase in adipocyte differentiation. PMID: 19360322

Show More

Hide All

Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver, testis, kidney, spleen, intestine, brain and adrenal gland.

Q&A

What is the molecular function of Insig2 protein and how does it differ from Insig1?

Insig2 is an endoplasmic reticulum (ER) membrane protein that regulates the proteolytic activation of sterol regulatory element-binding proteins (SREBPs), which are transcription factors that activate cholesterol and fatty acid synthesis in animal cells . While Insig1 and Insig2 are 59% identical and both bind SREBP cleavage-activating protein in a sterol-dependent manner, they differ primarily in their expression regulation . Insig1 is an obligatory SREBP target gene (creating a feedback loop), whereas Insig2 is expressed at a low but constitutive level and is not regulated by SREBPs . This fundamental difference makes Insig2 particularly important for maintaining basal regulation of lipid metabolism.

What are the different transcripts of mouse Insig2 and how can they be experimentally distinguished?

Mouse Insig2 exists in two transcript variants:

TranscriptExpression PatternRegulationDistinguishing Features
Insig2aLiver-specificDown-regulated by insulinDifferent non-coding first exon
Insig2bUbiquitousConstitutively expressedDifferent non-coding first exon

Both transcripts encode identical Insig2 proteins but differ in their non-coding first exons through the use of different promoters . These variants can be distinguished experimentally using transcript-specific RT-PCR with primers designed to target the unique first exons. For example, researchers have successfully detected both mRNA variants in mouse and rat liver using this approach, whereas only the Insig2b form was detected in human liver samples .

What optimal techniques should be used to study recombinant mouse Insig2 expression?

For studying recombinant mouse Insig2 expression, researchers should employ multiple complementary techniques:

  • RT-PCR and qPCR: For quantifying transcript levels and distinguishing between Insig2a and Insig2b variants. Design primers specific to the unique first exons of each variant .

  • Luciferase Reporter Assays: To study promoter activity and regulation. Construct reporter plasmids containing various lengths of the Insig2 promoter regions upstream of a luciferase gene, as demonstrated in studies of the human INSIG2 promoter .

  • Western Blotting: For protein-level detection, using specific antibodies against Insig2.

  • Chromatin Immunoprecipitation (ChIP): To identify transcription factors binding to the Insig2 promoter regions. The ChIP assay followed by real-time PCR has been successfully employed to study transcription factor binding to the human INSIG2 promoter .

How does insulin regulate mouse Insig2 expression and what experimental systems best demonstrate this?

Insulin differentially regulates the two Insig2 transcripts in mice. The liver-specific Insig2a transcript is down-regulated by insulin, while Insig2b remains constitutively expressed . This regulatory pattern has significant implications for hepatic lipid metabolism, as the insulin-mediated reduction in Insig2a allows SREBP1c processing to occur independently of hepatic cholesterol levels .

To experimentally study this regulation:

  • Primary Hepatocytes: Isolated rat hepatocytes have been used successfully to study insulin regulation of Insig2. Cells can be cultured in media with different glucose concentrations (1 g/L vs. 4.5 g/L) and with/without insulin (100 nM) stimulation .

  • Luciferase Reporter Assays: Transfecting hepatocytes with Insig2 promoter-reporter constructs and treating with insulin can demonstrate direct regulation of promoter activity .

  • Time-course Experiments: For examining the kinetics of insulin-mediated regulation of Insig2 expression.

What are the key considerations for producing and purifying functional recombinant mouse Insig2?

When producing recombinant mouse Insig2:

  • Expression System Selection: As Insig2 is a membrane protein, consider mammalian expression systems like HEK293 cells for proper folding and post-translational modifications.

  • Construct Design: Include appropriate purification tags that won't interfere with protein function. Consider a cleavable tag system.

  • Detergent Selection: Critical for membrane protein solubilization; test multiple detergents for optimal activity maintenance.

  • Functional Validation: After purification, verify that recombinant Insig2 maintains its ability to bind SREBP cleavage-activating protein and respond to sterols.

  • Storage Conditions: Optimize buffer composition, pH, and storage temperature to maintain protein stability and activity.

What transcription factors regulate mouse Insig2 expression, and how can their binding be experimentally validated?

Studies of the human INSIG2 promoter have identified key transcription factors and regulatory elements that likely have parallel functions in mouse Insig2 regulation:

  • Ets Family Transcription Factors: The Ets-a and Ets-b binding sites in the proximal promoter region are critical for INSIG2 expression . ELK1 and SAP1a (serum response factor accessory protein-1a) have been shown to bind to the Ets-a site .

  • Experimental Validation Methods:

    • Electrophoretic Mobility Shift Assays (EMSA): Using in vitro translated recombinant transcription factors and labeled probes covering binding sites of interest .

    • Chromatin Immunoprecipitation (ChIP): To confirm in vivo binding of transcription factors to the Insig2 promoter .

    • Site-directed Mutagenesis: To evaluate the functional importance of specific binding sites through reporter assays .

    • RNA Interference: Knockdown of specific transcription factors to assess their contribution to Insig2 expression .

  • Key Findings from Human Studies (applicable to mouse model design):

    • Mutation of the Ets-a site dramatically reduces promoter activity .

    • SAP1a binds to the Insig2 promoter in both HEK293T and HepG2 cells, while ELK1 binding was only detected in HEK293T cells .

    • Insulin activation of the INSIG2 promoter is mediated by phosphorylated SAP1a .

How can researchers effectively study the differential roles of Insig2 versus Insig1 in cholesterol homeostasis using recombinant proteins?

To differentiate the functions of Insig2 from Insig1:

  • Competitive Binding Assays: Using recombinant proteins to assess differential binding affinities to SREBP cleavage-activating protein and other partners.

  • Reconstitution Experiments: In Insig1/Insig2 double-knockout cell lines, introduce either recombinant Insig1 or Insig2 to assess unique functions.

  • Domain Swap Experiments: Create chimeric proteins by swapping domains between Insig1 and Insig2 to identify regions responsible for their functional differences.

  • Differential Response to Insulin: Design experiments that compare the response of Insig1 versus Insig2 expression to insulin stimulation, given that Insig2a is downregulated by insulin while Insig1 is not directly regulated by insulin .

  • Sterol Sensitivity Assays: Compare the sterol-dependent interactions of Insig1 and Insig2 with their binding partners to identify potential differences in sensitivity or kinetics.

What experimental approaches can effectively investigate Insig2's role in cancer metastasis?

Insig2 has been identified as a gene with negative prognostic capacity in human colon cancer and is associated with metastasis . To investigate this function using recombinant mouse Insig2:

How can researchers investigate the insulin-mediated post-translational modifications of mouse Insig2?

Insulin regulation of Insig2 likely involves post-translational modifications that affect its stability and function:

  • Phosphorylation Analysis:

    • Immunoprecipitate recombinant Insig2 from insulin-treated cells followed by mass spectrometry to identify phosphorylation sites.

    • Use phospho-specific antibodies to detect changes in phosphorylation status after insulin treatment.

    • Create phospho-mimetic and phospho-dead mutants to determine the functional significance of specific modifications.

  • Protein Stability Assays:

    • Pulse-chase experiments with cycloheximide to measure protein half-life with/without insulin treatment.

    • Ubiquitination assays to determine if insulin affects Insig2 degradation via the ubiquitin-proteasome pathway.

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify insulin-dependent changes in Insig2 interaction partners.

    • Proximity ligation assays to visualize interactions in situ.

  • Subcellular Localization:

    • Immunofluorescence or subcellular fractionation to determine if insulin affects Insig2 localization within the cell.

What are the optimal experimental designs for studying Insig2's role in the regulation of SREBP processing?

To study how recombinant mouse Insig2 regulates SREBP processing:

  • Reconstitution Systems:

    • Use cell lines lacking endogenous Insig proteins to introduce wild-type or mutant recombinant Insig2.

    • Compare effects on SREBP processing in response to varying sterol levels.

  • Real-time Visualization:

    • Create fluorescently tagged SREBP and Insig2 constructs to monitor their interactions and trafficking in living cells.

    • Use FRET or BRET approaches to quantify protein-protein interactions.

  • Structure-Function Analysis:

    • Generate recombinant Insig2 proteins with specific mutations to identify critical residues for SREBP interaction and regulation.

    • Compare activity of Insig2a and Insig2b proteins in SREBP processing assays.

  • Sterol-Dependence Assays:

    • Determine the sterol concentration-response relationship for Insig2-mediated SREBP regulation.

    • Compare sterol sensitivity between Insig1 and Insig2 in identical experimental systems.

  • In Vitro Reconstitution:

    • Develop membrane-based assays with purified components to study direct interactions and their regulation.

How should researchers interpret discrepancies between human and mouse Insig2 expression patterns?

When comparing human and mouse Insig2 data, researchers should consider several key differences:

  • Transcript Variation: While both Insig2a and Insig2b transcripts are detected in mouse and rat liver, only Insig2b is detected in human liver despite high sequence homology in the genomic region . This critical species difference must be considered when translating mouse findings to human biology.

  • Data Interpretation Framework:

ParameterMouseHumanExperimental Implication
TranscriptsInsig2a & Insig2bPrimarily Insig2bDesign species-specific primers for accurate detection
Insulin regulationInsig2a downregulatedDifferent mechanism likelySeparate experimental designs needed for each species
Promoter elementsMultiple regulatory sitesEts elements criticalSpecies-specific transcription factor analysis required
  • Methodological Considerations: When designing experiments, use species-matched cell lines and primary cells. Mouse hepatocytes for mouse Insig2 studies and human HepG2 or primary hepatocytes for human INSIG2 studies .

What statistical approaches are most appropriate for analyzing Insig2 expression data in complex disease models?

When analyzing Insig2 expression data in disease models:

  • For Prognostic Studies:

    • Kaplan-Meier survival analysis with log-rank tests to determine if Insig2 expression correlates with survival outcomes .

    • Cox proportional hazards models to analyze Insig2 as a prognostic factor while controlling for other variables .

    • Consider interaction terms to examine how Insig2 expression interacts with other factors (e.g., APC mutations in colon cancer) .

  • For Expression Analysis:

    • Paired statistical tests when comparing Insig2 expression in tumor vs. adjacent normal tissue from the same subjects.

    • ANOVA or mixed-effects models for data with multiple experimental factors.

    • Non-parametric alternatives when data don't meet normality assumptions.

  • For Functional Studies:

    • Repeated measures designs for time-course experiments examining Insig2 regulation.

    • Power analysis to determine appropriate sample sizes, especially for in vivo experiments.

How can researchers effectively control for potential artifacts when studying recombinant Insig2 in heterologous expression systems?

To minimize artifacts when using recombinant Insig2:

  • Expression Level Controls:

    • Titrate expression to physiological levels; overexpression can cause artifactual interactions.

    • Use inducible expression systems to control protein levels precisely.

  • Tag Interference Controls:

    • Compare N- and C-terminally tagged versions to identify tag-induced artifacts.

    • Include untagged versions as controls when possible.

    • Validate with multiple tag types (His, FLAG, GST) to confirm consistent results.

  • Cell Type Considerations:

    • Validate key findings in multiple cell types, including species-matched primary cells.

    • Compare results in cells with vs. without endogenous Insig2.

  • Functional Validation Experiments:

    • Complement expression studies with knockdown/knockout approaches.

    • Rescue experiments in Insig2-deficient cells to confirm specificity.

What are the most effective CRISPR-Cas9 strategies for studying mouse Insig2 function?

For CRISPR-Cas9 modification of Insig2:

  • Knockout Strategies:

    • Target early exons shared by both Insig2a and Insig2b to disrupt all isoforms.

    • Design guide RNAs with minimal off-target effects.

    • Consider conditional knockout systems for tissue-specific or inducible deletion.

  • Isoform-Specific Targeting:

    • Target the unique first exons to selectively disrupt either Insig2a or Insig2b.

    • Use paired guides to delete entire exons rather than relying on frameshift mutations.

  • Promoter Editing:

    • Target specific transcription factor binding sites (like Ets elements) to study their function in vivo .

    • Use base editing to introduce point mutations in key regulatory sequences.

  • Knock-in Applications:

    • Insert fluorescent reporters to monitor endogenous Insig2 expression.

    • Create tagged versions at the endogenous locus for interaction studies.

How can advanced imaging techniques be applied to study Insig2 protein dynamics in living cells?

To visualize Insig2 dynamics:

  • Fluorescent Protein Fusions:

    • Create functional Insig2-FP fusions that maintain proper localization and function.

    • Use photoactivatable or photoconvertible fluorescent proteins to track protein movement over time.

  • Super-resolution Microscopy Approaches:

    • STORM or PALM microscopy to resolve Insig2 distribution within the ER membrane.

    • Structured illumination microscopy for live-cell dynamics at improved resolution.

  • FRET-based Biosensors:

    • Develop sensors that report on Insig2 conformational changes upon sterol binding.

    • Create intermolecular FRET pairs to monitor Insig2 interactions with SREBP cleavage-activating protein.

  • Single-molecule Tracking:

    • Use sparse labeling approaches to follow individual Insig2 molecules in the ER membrane.

    • Quantify diffusion coefficients and binding kinetics in different cellular conditions.

What are the most promising approaches for developing selective modulators of Insig2 versus Insig1 function?

To develop selective Insig2 modulators:

  • Structure-based Design:

    • Leverage structural differences between Insig1 and Insig2 to design selective compounds.

    • Focus on regions with low sequence homology (41% difference between proteins) .

  • High-throughput Screening Approaches:

    • Develop cell-based assays that specifically report on Insig2 function.

    • Screen for compounds that selectively modulate Insig2-mediated SREBP processing.

  • Peptide-based Inhibitors:

    • Design peptides mimicking protein interaction interfaces specific to Insig2.

    • Use stapled peptides for improved stability and membrane permeability.

  • Allosteric Modulators:

    • Target regulatory sites unique to Insig2 that affect its activity without disrupting the main binding interface.

What are the most promising avenues for understanding Insig2's role in metabolic diseases beyond its established function in cholesterol regulation?

Emerging research directions include:

  • Insig2 in Insulin Resistance:

    • Investigate how altered Insig2 regulation affects insulin sensitivity.

    • Explore the reciprocal relationship between insulin signaling and Insig2 function.

  • Non-canonical Functions:

    • Study potential roles beyond SREBP regulation, such as interactions with other regulatory proteins.

    • Investigate Insig2's inhibition of Bax-mediated apoptosis and its implications for cell survival during metabolic stress.

  • Tissue-specific Functions:

    • Compare Insig2 functions across different metabolically active tissues.

    • Explore potential roles in brown adipose tissue and muscle metabolism.

  • Role in Inflammation:

    • Investigate potential links between Insig2-mediated lipid metabolism and inflammatory pathways.

    • Explore how Insig2 may influence metabolic inflammation in conditions like NASH.

How might single-cell approaches advance our understanding of heterogeneous Insig2 expression and function?

Single-cell technologies offer new opportunities:

  • Single-cell RNA-seq:

    • Profile Insig2a vs. Insig2b expression across individual cells within tissues.

    • Identify cell populations with unique Insig2 regulatory patterns.

    • Correlate Insig2 expression with other metabolic genes at single-cell resolution.

  • Spatial Transcriptomics:

    • Map Insig2 expression patterns within tissue architecture.

    • Identify spatial relationships between Insig2-expressing cells and metabolic zonation.

  • CyTOF and Single-cell Proteomics:

    • Quantify Insig2 protein levels alongside post-translational modifications and interacting partners.

    • Identify rare cell populations with unique Insig2 regulatory states.

  • Live-cell Single-molecule Imaging:

    • Track individual Insig2 molecules to reveal dynamic behaviors not apparent in population measurements.

    • Quantify stochastic variations in Insig2 function across individual cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.