Recombinant Mouse Integral membrane protein 2B (Itm2b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
Itm2b; Integral membrane protein 2B; Immature BRI2; imBRI2; Protein E25B; Transmembrane protein BRI; Bri
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Itm2b
Target Protein Sequence
MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICS
Uniprot No.

Target Background

Function
Integral membrane protein 2B (ITM2B) plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of amyloid-beta peptide aggregation and fibril deposition. It plays a role in the induction of neurite outgrowth. ITM2B functions as a protease inhibitor by blocking access of secretases to APP cleavage sites. Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing, leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42. Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers.
Gene References Into Functions

Research Highlights

  1. Data indicate that double transgenic (Tg-FDD-Tau) mice showed a significant decrease in synaptophysin levels. PMID: 23418567
  2. BRI2 protein regulates beta-amyloid degradation by increasing levels of secreted insulin-degrading enzyme (IDE). PMID: 21873424
  3. Suggest that Adam7 functions in fertilization through the formation of a complex with heat shock protein 5, calnexin and Itm2b during capacitation in sperm. PMID: 20945367
  4. The short form of ITM2B induces apoptosis in IL-2-stimulated cells. The long form cannot induce it. ITM2B(s) interacts with Bcl-2, but not with Bad. Mutation of the L and D residues in the BH3 domain abolished the ability of ITM2B(s) to promote apoptosis. PMID: 12082633
  5. ITM2B(S) induces apoptosis via a caspase-dependent mitochondrial pathway. PMID: 12442332
  6. BH3-only protein ITM2Bs is able to induce apoptotic cell death in p53+/+, as well as in p53-/- cell lines. PMID: 14741382
  7. Itm2b mRNA was differentially expressed in mouse male reproductive tissues, during sexual maturation and up-regulated by testosterone. PMID: 17873332
Database Links
Protein Families
ITM2 family
Subcellular Location
[Integral membrane protein 2B]: Golgi apparatus membrane; Single-pass type II membrane protein.; [BRI2, membrane form]: Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.; [Bri23 peptide]: Secreted.; [BRI2C, soluble form]: Secreted.

Q&A

What is Integral Membrane Protein 2B (Itm2b/BRI2)?

Itm2b, also known as BRI2, is a type II ubiquitous transmembrane protein encoded by the Itm2b gene. It is highly expressed in both brain and retinal tissues, suggesting important roles in neural function. Structurally, Itm2b is synthesized as a precursor (immature, imBRI2) that undergoes cleavage at the C-terminus by proprotein convertase to produce mature BRI2 protein (mBRI2) and a 23 amino acid-long (Bri23) soluble C-terminal fragment. This protein exhibits significant conservation across species, with the mouse variant sharing substantial homology with the human version, making it an excellent model for studying human neurodegenerative conditions .

What are the primary functions of Itm2b?

While the complete functional profile of Itm2b remains under investigation, several key roles have been identified. Itm2b plays a regulatory role in processing the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of amyloid-beta peptide aggregation and fibril deposition. The protein is involved in triggering apoptosis and suppressing tumor formation. Additionally, Itm2b has demonstrated involvement in neurite outgrowth and functions as a protease inhibitor by blocking secretase access to APP cleavage sites. Recent research has revealed its dual physiological role in regulating excitatory synaptic transmission at both presynaptic and postsynaptic termini .

How is Itm2b involved in neurological disorders?

Mutations in the Itm2b gene have been linked to several neurodegenerative conditions. In humans, mutations resulting in extended protein products cause familial British dementia (FBD) and familial Danish dementia (FDD), both characterized by early-onset progressive dementia and cerebellar ataxia. These conditions share neurological features with Alzheimer's disease, including severe cerebral amyloid angiopathy, non-neuritic plaques, and fibrillary tangles. The pathogenesis appears to involve both loss of BRI2 function and/or accumulation of amyloidogenic mutant BRI2-derived peptides, which impair synaptic long-term potentiation (LTP). Interestingly, recent studies have identified co-localization between ITM2B protein and intracellular Tau pathology in Alzheimer's disease neuropathologic changes, suggesting involvement in Tau-related neurodegeneration .

What genetic models are available for studying Itm2b function?

Several genetic approaches have been developed to study Itm2b function in mice. Conditional knockout models allow for tissue-specific inactivation of Itm2b, particularly valuable in neurological research. For example, researchers have successfully inactivated Itm2b in either presynaptic (CA3), postsynaptic (CA1), or both (CA3+CA1) neurons of the hippocampal Schaffer-collateral pathway. These models provide powerful tools for investigating the region-specific roles of Itm2b in synaptic transmission and neurodegeneration. Additionally, transgenic models expressing mutant forms of Itm2b associated with human dementia (such as the Danish and British variants) allow for the study of pathogenic mechanisms underlying these conditions .

What are the recommended methods for Itm2b protein detection?

Multiple approaches exist for detecting Itm2b protein in experimental samples. Western blotting using polyclonal antibodies directed against epitopes within amino acids 50-250 of human ITM2B has been validated for mouse, rat, and human samples. For cellular localization, immunocytochemistry and immunofluorescence techniques using these antibodies are effective. When selecting antibodies, researchers should consider the specific domain of interest, as different antibodies may recognize different epitopes or processed forms of the protein. For more sensitive detection, mass spectrometry-based approaches have been successfully employed to identify Itm2b and its binding partners in tissue samples .

How can researchers isolate and characterize Itm2b protein complexes?

Isolation of Itm2b protein complexes is typically achieved through immunoprecipitation using validated anti-Itm2b antibodies. For comprehensive characterization of binding partners, quantitative mass spectrometry-based proteomics has proven effective. This approach involves extracting whole proteins from tissue samples, conducting immunoprecipitation with anti-Itm2b antibodies raised against different epitopes, and analyzing the precipitated complexes using mass spectrometry. This methodology has successfully identified hundreds of potential Itm2b interaction partners in human retina, providing insights into its functional networks. Similar approaches can be applied to mouse tissues or cellular models expressing recombinant Itm2b .

How does presynaptic versus postsynaptic Itm2b affect synaptic function?

Research utilizing conditional knockout models has revealed distinct roles for Itm2b at presynaptic and postsynaptic terminals. AMPAR-mediated responses decrease after postsynaptic but not presynaptic deletion of Itm2b, indicating a postsynaptic role in maintaining receptor function or trafficking. In contrast, the probability of spontaneous glutamate release decreases while short-term synaptic facilitation increases primarily after presynaptic deletion of Itm2b, suggesting presynaptic regulation of neurotransmitter release probability. The dual functionality at both synaptic sites indicates Itm2b serves as an important regulator of excitatory synaptic transmission through multiple mechanisms. These findings suggest researchers should carefully consider the specific synaptic compartment when designing experiments to study Itm2b function in neural circuits .

What is the relationship between Itm2b and amyloid precursor protein processing?

Mature BRI2 (mBRI2) functions as a modulator of amyloid-beta A4 precursor protein (APP) processing, significantly reducing the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42. Mechanistically, Itm2b appears to function as a protease inhibitor by blocking access of secretases to APP cleavage sites. Additionally, the Bri23 peptide, released after proteolytic processing of Itm2b, prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers. When investigating these interactions, researchers should consider employing co-immunoprecipitation, proximity ligation assays, or FRET-based approaches to capture the dynamic nature of these protein-protein interactions. Understanding this relationship is crucial for developing therapeutic strategies targeting amyloid-related pathologies .

What are the recommended approaches for studying Itm2b in neurodegenerative models?

When studying Itm2b in neurodegenerative contexts, researchers should consider multipronged approaches that address both protein function and pathology. Immunohistochemical co-localization studies have effectively demonstrated relationships between Itm2b and pathological markers such as Tau and amyloid plaques. For example, researchers have observed frequent co-localization between ITM2B protein and intracellular Tau pathology in Alzheimer's disease neuropathologic changes, with weaker co-localization with TDP-43 pathology. Co-localization of intracellular ITM2B pathology with Thioflavin-S in neurofibrillary tangles (NFTs) suggests a potential role for ITM2B in marking neurons transitioning from early to late stages of tangle-related neurodegeneration. These techniques, combined with behavioral assessments and electrophysiological recordings, provide comprehensive insights into Itm2b's role in disease progression .

What expression systems are optimal for producing recombinant mouse Itm2b?

The selection of an expression system for recombinant mouse Itm2b production depends on the specific research requirements. For structural studies requiring high protein yield, bacterial expression systems like E. coli can be utilized, though they may lack appropriate post-translational modifications. For functional studies necessitating proper protein folding and modification, mammalian expression systems such as HEK293 or CHO cells are preferable. These systems more accurately recapitulate the natural processing and trafficking of Itm2b. When designing expression constructs, researchers should consider including affinity tags for purification while ensuring these additions don't interfere with protein function. Additionally, co-expression with relevant processing enzymes may be necessary to obtain properly matured Itm2b protein for certain applications .

What are the key considerations when designing mutations in recombinant Itm2b?

When designing mutations in recombinant Itm2b for functional studies, researchers should consider the specific domains and processing sites that may affect protein function. The C-terminal region is particularly important, as it contains the furin cleavage site necessary for generating the Bri23 peptide. Mutations affecting this site would impact normal proteolytic processing. Additionally, transmembrane domains and interaction interfaces with binding partners like APP should be carefully considered. For modeling disease-associated mutations, researchers often reproduce the Danish mutation (a 10-nucleotide insertion) or the British mutation (a point mutation affecting the stop codon). Bioinformatic tools and structural modeling can help predict the effects of novel mutations on protein folding and function before experimental validation .

How can researchers validate the functionality of recombinant mouse Itm2b?

Validating the functionality of recombinant mouse Itm2b requires multiple complementary approaches. At the molecular level, proper protein processing can be assessed via Western blotting to confirm the generation of mature BRI2 and the Bri23 peptide. Subcellular localization should be verified through immunocytochemistry to ensure proper membrane targeting. Functional validation can include assessing interactions with known binding partners such as APP through co-immunoprecipitation or proximity ligation assays. For physiological relevance, researchers can determine whether the recombinant protein can rescue phenotypes in Itm2b-deficient cellular or animal models. Electrophysiological recordings can validate whether recombinant Itm2b properly modulates synaptic transmission in neuronal systems .

What is the significance of Itm2b in retinal function and pathology?

Recent proteomics studies have identified a substantial Itm2b interactome in the human retina, with 457 potential binding partners including 8 proteins involved in visual transduction. This extensive network suggests important roles for Itm2b in retinal function beyond its established roles in the brain. Interestingly, a missense mutation in ITM2B has been reported in an unusual retinal dystrophy without dementia, indicating tissue-specific roles for the protein. This finding suggests researchers studying recombinant mouse Itm2b should consider retinal phenotypes in addition to neurological effects when characterizing novel mutations or interventions. Future research directions may include investigating the specific roles of Itm2b in photoreceptor function, retinal pigment epithelium maintenance, and protection against retinal degeneration .

How might Itm2b be involved in mitochondrial function?

Gene Ontology analyses of Itm2b binding partners have revealed surprising connections to mitochondrial homeostasis. This unexpected finding suggests potential roles for Itm2b in regulating energy metabolism, mitochondrial dynamics, or mitochondrial-associated membrane functions. Researchers working with recombinant mouse Itm2b may wish to explore these connections through mitochondrial function assays, colocalization studies with mitochondrial markers, or assessment of mitochondrial morphology and function in Itm2b-manipulated systems. Given the importance of mitochondrial dysfunction in neurodegenerative diseases, this represents a promising avenue for understanding how Itm2b mutations might contribute to pathology through disrupted energy homeostasis or increased oxidative stress .

What are the therapeutic implications of modulating Itm2b function?

Understanding the multiple functions of Itm2b opens several potential therapeutic avenues for neurodegenerative and retinal diseases. The protein's role in inhibiting amyloid-beta aggregation suggests that recombinant Itm2b or derived peptides might serve as therapeutic agents for Alzheimer's disease. Similarly, its role in APP processing could be targeted to modulate amyloid production. For familial British and Danish dementias caused by Itm2b mutations, gene therapy approaches aiming to restore normal protein function could be explored. Researchers working with recombinant mouse Itm2b can contribute to these therapeutic directions by identifying specific functional domains, developing structure-based drug design targeting Itm2b-protein interactions, or testing Itm2b-derived peptides for neuroprotective effects in relevant disease models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.