Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2A (Ifi27l2a)

Shipped with Ice Packs
In Stock

Description

Neuroinflammation and Ischemic Stroke

  • Microglial Activation: Ifi27l2a is upregulated in aged and post-stroke microglia, driving pro-inflammatory phenotypes via mitochondrial ROS and reduced respiratory capacity .

  • Stroke Outcomes: Hemizygous deletion (Ifi27l2a+/−) reduces cortical infarct size by 50%, attenuates gliosis, and improves motor recovery in murine stroke models .

  • Mechanism: Overexpression in microglia increases Il1b, Trem2, and Mmp9 expression while suppressing reparative disease-associated microglia (DAM) genes .

Antiviral Activity

  • West Nile Virus (WNV): Ifi27l2a−/− mice exhibit higher CNS viral loads and mortality due to impaired neuronal cell death pathways .

  • Hepatitis C Virus (HCV): Human homolog IFI27 restricts HCV replication by promoting NS5A protein degradation via SKP2-mediated ubiquitination .

Mitochondrial Regulation

  • ROS Production: Ifi27l2a overexpression in microglia elevates mitochondrial ROS (Mitosox+ cells: 45% vs. 15% in controls) .

  • Respiration Defects: Reduces maximal mitochondrial respiration by 30% and spare respiratory capacity by 40% .

In Vitro Studies

ModelFindingsSource
Primary Mouse MicrogliaTNF-α/IFN-γ treatment increases Ifi27l2a mRNA (4.5-fold) and protein (3.7-fold) .
Sim-A9 Microglial Cell LineIfi27l2a overexpression induces amoeboid morphology and Il1b upregulation .
Human HMC3 MicrogliaInflammation/OGD upregulates IFI27L2 mRNA (3.2-fold) and protein .

In Vivo Studies

ModelFindingsSource
Ifi27l2a+/− Mice (Stroke)50% smaller cortical infarcts at PSD3; reduced thalamic gliosis at PSD14 .
Ifi27l2a−/− Mice (WNV)10-fold higher cerebellar viral titers; delayed neuronal apoptosis .
LPS-Induced EndotoxemiaPlasma Ifi27l2a increases 3.2-fold in aged mice (122.1 pg/ml vs. 38.1 pg/ml) .

Therapeutic Implications

  • Stroke Therapy: Partial Ifi27l2a reduction mitigates neuroinflammation, suggesting therapeutic targeting potential .

  • Antiviral Strategies: Enhancing Ifi27l2a activity could restrict neurotropic viruses like WNV .

  • Inflammatory Diseases: Blocking Ifi27l2a signaling may attenuate microglial ROS and DAM suppression .

Future Directions

  • Aged Stroke Models: Validate Ifi27l2a effects in aged animals to mimic human stroke pathology .

  • Cell-Type Specificity: Explore divergent roles in neurons (pro-apoptotic) vs. microglia (pro-inflammatory) .

  • Human Relevance: Assess IFI27L2 homologs in neuroinflammatory diseases using patient-derived samples .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based buffer, containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
25-90aa
Mol. Weight
7.3 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Ifi27l2a
Target Protein Sequence
AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Ifi27l2a potentially plays a role in the interferon-induced negative regulation of NR4A1, NR4A2, and NR4A3 transcriptional activity by enhancing XPO1-mediated nuclear export of these nuclear receptors. By modulating NR4A1 transcriptional activity, it may contribute to the vascular response to injury.
Gene References Into Functions
  1. Studies indicate that Ifi27l2a exhibits an antiviral phenotype in specific cell subsets, suggesting that certain interferon-stimulated genes have distinct inhibitory functions in particular tissues during West Nile virus infection. PMID: 26699642
  2. The upregulation of Ifi27l2a in infected lungs is primarily attributed to the infiltration of macrophages and lymphocytes. Interestingly, deletion of Ifi27l2a in mouse knockout lines did not result in increased susceptibility to infections. PMID: 25184786
  3. Ifi27l2a has been identified as a modulator of innate immune responses in sepsis models. PMID: 23747037
  4. Research has revealed a feedback loop activated by interferons through interferon-stimulated gene 12, which inhibits the vasculoprotective functions of NR4A1 nuclear receptors. PMID: 22427340
  5. Ifi27l2a is induced to higher levels in the brains of weanling mice than neonatal mice during Sindbis virus encephalitis, significantly delaying death in neonatal mice (interferon-inducible protective protein, ISG12). PMID: 12388728
  6. ISG12b is a candidate for an adipocytokine induced to express in adipose tissue by interferon. PMID: 17704618
  7. Mitochondrial-localized ISG12b1 protein inhibits adipocyte differentiation and mitochondrial biogenesis and function. PMID: 18948406

Show More

Hide All

Database Links
Protein Families
IFI6/IFI27 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is Ifi27l2a and what is its primary function in mice?

Interferon alpha-inducible protein 27 like 2A (Ifi27l2a) is a protein primarily induced by interferons for viral host defense and has been linked with pro-inflammatory cellular mechanisms. Recent research has identified it as a critical neuroinflammatory mediator, particularly in the context of ischemic stroke . Ifi27l2a is significantly up-regulated in microglia following stroke, with particularly pronounced expression in the aged brain.

The primary functions of Ifi27l2a include:

  • Regulation of inflammatory responses in microglia

  • Promotion of pro-inflammatory phenotypes in microglia

  • Stimulation of mitochondrial reactive oxygen species (ROS) production

  • Contribution to inflammatory-mediated brain injury after stroke

Experimental evidence shows that induction of Ifi27l2a in microglia is sufficient to stimulate mitochondrial ROS production and promote a pro-inflammatory phenotype, suggesting it may serve as a molecular switch triggering inflammatory responses .

How is Ifi27l2a expression regulated in normal and pathological conditions?

Ifi27l2a expression is tightly regulated under normal conditions but becomes dysregulated in several pathological states. The following factors influence Ifi27l2a expression:

Condition/FactorEffect on Ifi27l2a ExpressionEvidence
AgingMild upregulationIncreased baseline expression in aged vs. young microglia
Ischemic strokeSignificant upregulationMarkedly elevated in microglia post-stroke, particularly in aged brains
Pro-inflammatory cytokinesInductionTNFα and IFNγ treatment increases Ifi27l2a at both mRNA and protein levels
Viral infectionUpregulationBoth interferons (IFN α and β) and certain viral infections upregulate Ifi27l2a in the brain

In experimental settings, primary mouse microglia treated with TNFα and IFNγ showed significant upregulation of Ifi27l2a mRNA after 24 hours and increased intracellular Ifi27l2a protein after 48 hours of stimulation . This regulation appears to be part of a broader inflammatory cascade initiated by various pathological insults.

Which cell types predominantly express Ifi27l2a in the mouse brain?

While Ifi27l2a can be expressed by various cell types, single-cell RNA sequencing (scRNA-seq) analysis has revealed distinct expression patterns across brain cell populations:

Cell TypeIfi27l2a Expression LevelNotes
MicrogliaHighest expression following strokeParticularly elevated in activated microglia subtypes
Monocyte/MacrophagesHigher baseline expression than microgliaRepresent a small percentage (3.5%) of total microglia/macrophages in sham samples
Other CNS cellsLow/negligible expressionNot significantly upregulated after stroke compared to microglia

Detailed subclustering analysis of aged brain scRNA-seq data identified eight distinct microglia/macrophage populations with varying Ifi27l2a expression patterns. The protein was particularly upregulated in activated microglia subclusters, including Lag3+ activated microglia, Tyrobp+ activated microglia, and disease-associated microglia (DAM)-like clusters characterized by high expression of Lpl, Itgax, Cst7, and Spp1 .

How does Ifi27l2a contribute to microglial pro-inflammatory phenotypes?

Ifi27l2a plays a multifaceted role in promoting microglial pro-inflammatory phenotypes through several mechanisms:

  • Morphological changes: Overexpression of Ifi27l2a in microglial cells via lentiviral vectors results in characteristic morphological changes, with cells adopting round and amoeboid shapes typical of activated microglia. Quantitative analysis showed a significant increase in the percentage of cells with altered morphology in Ifi27l2a-lentivirus infected cells compared to control-lentivirus infected cells .

  • Inflammatory gene expression: Ifi27l2a overexpression significantly increases the expression of key pro-inflammatory cytokines:

    • Interleukin-1β (Il1b): 2-3 fold increase

    • Interleukin-1α (Il1a): 3-4 fold increase
      These changes occur without significantly affecting microglial marker Tmem119 expression .

  • Mitochondrial dysfunction and ROS production: Ifi27l2a overexpression significantly increases CellRox dye intensity, indicating elevated reactive oxygen species (ROS) production. This effect is most pronounced in cells expressing high levels of Ifi27l2a (as indicated by GFP co-expression) .

  • Reduced mitochondrial respiration: Though not directly stated in the provided text, the connection between increased ROS and mitochondrial dysfunction suggests Ifi27l2a may impair normal mitochondrial function.

These findings collectively suggest that Ifi27l2a may serve as a molecular switch driving microglial cells toward a pro-inflammatory state during aging and following pathological insults like stroke .

What are the effects of Ifi27l2a reduction on stroke outcomes?

Partial reduction of Ifi27l2a expression produces significant neuroprotective effects in experimental stroke models. Researchers used Ifi27l2a heterozygous (Ifi27l2a+/-) mice with approximately 50% reduction in Ifi27l2a expression to investigate these effects:

Outcome MeasureEffect of Ifi27l2a ReductionTiming
Cortical infarct volumeSignificantly reduced (approximately 50%)Post-stroke day (PSD) 3
Brain atrophySignificantly reducedPSD 30
Microgliosis (Iba1+ cells)Reduced in peri-infarct cortexPSD 14
Astrogliosis and microgliosisReduced in ipsilateral thalamusPSD 14
Sensory-motor functionImprovedThrough 1-2 weeks post-stroke

These findings were observed in both male and female mice, indicating the robustness of the effect across sexes. Importantly, even partial reduction of Ifi27l2a expression proved sufficient to attenuate inflammatory responses and improve outcomes, suggesting that complete ablation may not be necessary for therapeutic benefit .

The researchers used a permanent distal middle cerebral artery occlusion (pdMCAO) model, which allowed evaluation of both early cortical infarct and delayed thalamic inflammation. This model is particularly useful for studying secondary injury processes that occur after the initial stroke event .

What methodologies are most effective for studying Ifi27l2a expression at the single-cell level?

Based on the research approaches described in the search results, several methodologies have proven effective for studying Ifi27l2a expression at the single-cell level:

  • Single-cell RNA sequencing (scRNA-seq):

    • Enables comprehensive transcriptional profiling of individual cells

    • Allows identification of cell-specific Ifi27l2a expression patterns

    • Permits subclustering analysis to identify specific microglial subpopulations with differential Ifi27l2a expression

    • Can be combined with trajectory analysis to map temporal changes in expression

  • Flow cytometry with cell-specific markers:

    • Researchers used Tmem119 as a microglia-specific marker to isolate and analyze Ifi27l2a expression

    • Gating strategies employing Tmem119 fluorescence minus one (FMO) controls help exclude non-microglial populations

    • Enables quantification of Ifi27l2a protein levels in specific cell populations

  • Quantitative RT-PCR of sorted cell populations:

    • Provides sensitive quantification of Ifi27l2a mRNA levels

    • Can be performed on FACS-isolated microglia to confirm scRNA-seq findings

    • Useful for comparing expression levels between different experimental conditions

  • Lentiviral expression systems with fluorescent reporters:

    • Enables functional studies by overexpressing Ifi27l2a in specific cell types

    • Co-expression of eGFP allows visualization and tracking of Ifi27l2a-expressing cells

    • Facilitates analysis of morphological and functional changes induced by Ifi27l2a

The most robust approach combines multiple methodologies - for example, using scRNA-seq to identify expression patterns, followed by flow cytometry and qRT-PCR for validation, and lentiviral systems for functional studies.

What are the optimal experimental models for studying Ifi27l2a function in neuroinflammation?

Several experimental models have proven effective for investigating Ifi27l2a function in neuroinflammation, each with specific advantages for addressing different research questions:

  • Permanent distal Middle Cerebral Artery Occlusion (pdMCAO) model:

    • Creates cortical infarction with delayed secondary injury in the thalamus

    • Allows evaluation of both acute and chronic injury processes

    • Enables assessment of both primary injury (cortex) and secondary injury (thalamus)

    • Particularly useful for studying age-dependent differences in stroke response

  • Primary microglial cultures:

    • Allow direct manipulation of Ifi27l2a expression in a controlled environment

    • Useful for mechanistic studies of Ifi27l2a function

    • Can be stimulated with LPS, TNFα, and IFNγ to mimic inflammatory conditions

    • Enable detailed analysis of cellular morphology and inflammatory responses

  • Microglial cell lines (e.g., Sim-A9):

    • Provide a homogeneous cell population for high-throughput studies

    • Suitable for lentiviral transduction and genetic manipulation

    • Allow assessment of morphological and functional changes

    • Useful for studying mitochondrial function and ROS production

  • Human microglial models (e.g., HMC3 cells):

    • Enable translation of findings to human biology

    • Can be subjected to oxygen-glucose deprivation (OGD) to model ischemic conditions

    • Allow assessment of whether findings in mouse models extend to human cells

  • Genetic models (Ifi27l2a+/- mice):

    • Provide system-wide reduction in Ifi27l2a expression

    • Enable in vivo assessment of Ifi27l2a function

    • Allow longitudinal studies of stroke outcomes

    • Particularly valuable for behavioral and functional outcome assessment

The most comprehensive approach involves combining these models - for example, using genetic models for in vivo studies, complemented by cell culture models for detailed mechanistic investigations.

How can researchers effectively manipulate Ifi27l2a expression for functional studies?

The search results reveal several effective strategies for manipulating Ifi27l2a expression to study its function:

  • Lentiviral overexpression:

    • The researchers successfully used lentiviral vectors with Cx3cr1 promoter (Lenti-Cx3cr1-Ifi27l2a-eGFP) to drive Ifi27l2a expression specifically in microglial cells

    • Co-expression of eGFP allows visualization and tracking of transduced cells

    • This approach enabled analysis of morphological changes and inflammatory responses induced by Ifi27l2a overexpression

    • The vector design included specific primer binding regions for validation of expression

  • Genetic reduction models:

    • Ifi27l2a heterozygous (Ifi27l2a+/-) mice provided a model with partial reduction (~50%) of Ifi27l2a expression

    • This approach is particularly valuable for in vivo studies and has translational relevance, as complete ablation may not be necessary or achievable in therapeutic settings

    • Researchers confirmed reduced Ifi27l2a expression (~68% reduction) in primary microglia from heterozygous mice by qRT-PCR

  • Pro-inflammatory stimulation:

    • Treatment with TNFα (20 ng/ml) and IFNγ (20 ng/ml) induces Ifi27l2a expression in primary microglia

    • This approach mimics inflammatory conditions and allows study of the regulation of endogenous Ifi27l2a

    • The effect is time-dependent, with increased mRNA at 24 hours and increased protein at 48 hours

  • Oxygen-glucose deprivation (OGD):

    • Combined with pro-inflammatory cytokines, OGD can induce Ifi27l2a expression in human microglial cells (HMC3)

    • This approach models ischemic conditions and is valuable for translational studies

Each manipulation strategy offers specific advantages depending on the research question, with lentiviral approaches offering precise cellular targeting, genetic models providing system-wide effects, and stimulation protocols modeling pathological conditions.

What behavioral assays are most sensitive for detecting improvements after Ifi27l2a modulation?

While the search results don't provide exhaustive details on behavioral testing, they indicate that sensory-motor function tests were effective in detecting improvements in Ifi27l2a heterozygous mice following stroke:

"Behavioral tests focusing on sensory-motor function also showed improved outcome in the Ifi27l2a het mice through 1,2 weeks after stroke."

Based on this information and common practices in stroke research, the following behavioral assays would likely be most sensitive for detecting improvements after Ifi27l2a modulation:

  • Sensory-motor assessments:

    • Rotarod test: Measures motor coordination and balance

    • Cylinder test: Evaluates forelimb use asymmetry

    • Corner test: Assesses sensorimotor and postural asymmetries

    • Grid-walking test: Measures fine motor coordination and placement

  • Functional outcome measures:

    • Neurological deficit scoring: Standardized assessment of neurological function

    • Adhesive removal test: Evaluates sensory and motor function

    • Beam walking test: Assesses motor coordination and balance

The research indicates that improvements were detectable through 1-2 weeks post-stroke, suggesting that these tests are sensitive within this timeframe . For comprehensive assessment, a battery of complementary tests is recommended to capture different aspects of sensory-motor function.

How should researchers account for heterogeneity in microglial populations when analyzing Ifi27l2a expression?

The search results highlight significant heterogeneity in Ifi27l2a expression across microglial subpopulations, necessitating specific analytical approaches:

  • Detailed subclustering analysis:

    • The researchers identified 26 distinct cell populations in aged brain, including eight microglial/macrophage clusters

    • These included homeostatic microglia (Siglech+ and P2ry12+), activated microglia (Lag3+ and Tyrobp+), monocyte-macrophage populations, and disease-associated microglia (DAM-like)

    • Ifi27l2a expression varied significantly across these subclusters

  • Cell-specific marker integration:

    • Analysis should incorporate established markers for microglial subtypes:

      • Homeostatic microglia: Siglech, Tmem119, Gpr34, P2ry12, Selplg

      • Disease-associated microglia: Lpl, Itgax, Cst7, Spp1

      • Monocyte-macrophages: Mrc1, Ms4a7, Pf4, Flt3, Clec12a

    • These markers help contextualize Ifi27l2a expression within specific functional states

  • Differential expression analysis across conditions:

    • Comparison of expression patterns between experimental conditions (e.g., young vs. aged, sham vs. stroke) should be performed separately for each microglial subcluster

    • This approach revealed that Ifi27l2a induction varied across subtypes, with some showing more pronounced upregulation than others

  • Cell isolation validation:

    • When isolating specific cell populations for targeted analysis (e.g., Tmem119+ microglia), appropriate controls such as fluorescence minus one (FMO) should be used to ensure population purity

    • This approach allows more accurate quantification of Ifi27l2a expression in specific cell types

By implementing these analytical strategies, researchers can more accurately characterize the cell type-specific expression patterns of Ifi27l2a and better understand its differential roles across microglial subpopulations.

What are the challenges in establishing causality between Ifi27l2a upregulation and neuroinflammatory phenotypes?

Establishing causality between Ifi27l2a upregulation and neuroinflammatory phenotypes presents several challenges that researchers should address:

  • Distinguishing primary from secondary effects:

    • The study notes that reduced cortical injury following Ifi27l2a reduction could influence secondary thalamic injury: "our results cannot currently distinguish between a direct effect of reducing secondary injury versus a reduced cortical injury involving less thalamocortical fiber damage."

    • This highlights the challenge of determining whether Ifi27l2a directly affects secondary injury or if effects are mediated through primary injury reduction

  • Temporal dynamics of expression and inflammation:

    • Ifi27l2a upregulation and inflammatory responses unfold over time, making it difficult to establish which precedes the other

    • The research used a single timepoint (PSD 14) for scRNA-seq analysis, limiting understanding of temporal relationships

  • Compensatory mechanisms in genetic models:

    • Partial genetic reduction (heterozygous mice) may trigger compensatory changes that influence outcomes

    • These compensatory mechanisms could confound interpretation of the direct effects of Ifi27l2a

  • Cell-type specific effects:

    • Ifi27l2a is expressed in multiple cell types, with varying levels and potentially different functions

    • Effects observed in global reduction models may represent a complex interplay of cell-specific responses

  • Interaction with age-related factors:

    • The study shows age-dependent upregulation of Ifi27l2a, suggesting interaction with age-related factors

    • This interaction complicates determination of Ifi27l2a's specific contribution to inflammatory phenotypes

To address these challenges, the researchers employed multiple complementary approaches:

  • In vitro overexpression studies to demonstrate direct effects of Ifi27l2a on microglial phenotype

  • Ex vivo analysis of primary microglia from Ifi27l2a+/- mice to confirm reduced inflammatory responses

  • In vivo stroke models to assess functional outcomes

  • Analysis of both primary and secondary injury sites

This multi-modal approach strengthens causal inference by demonstrating consistent effects across different experimental paradigms.

What are the potential therapeutic implications of targeting Ifi27l2a?

The research results suggest several promising therapeutic implications for targeting Ifi27l2a in neurological conditions:

  • Stroke therapy:

    • Partial reduction of Ifi27l2a expression significantly reduced both acute cortical infarct (by approximately 50%) and chronic brain atrophy following stroke

    • Improved sensory-motor outcomes were observed in Ifi27l2a heterozygous mice through 1-2 weeks post-stroke

    • These findings suggest that therapies targeting Ifi27l2a could potentially reduce stroke damage and improve functional recovery

  • Neuroinflammatory conditions:

    • Given that Ifi27l2a drives microglial activation and pro-inflammatory phenotypes, targeting this protein could potentially benefit multiple neuroinflammatory conditions

    • The ability of Ifi27l2a reduction to attenuate microgliosis and astrogliosis suggests broad applicability

  • Age-related neurodegeneration:

    • Ifi27l2a shows age-dependent upregulation and may contribute to age-related neuroinflammatory processes

    • Targeting Ifi27l2a could potentially mitigate age-associated neuroinflammation

  • Partial inhibition strategy:

    • The study intentionally used heterozygous mice with partial (~50%) Ifi27l2a reduction, reasoning that this "would reflect a more realistic therapeutic goal" and have "increased translational relevance"

    • The success of this approach suggests that complete inhibition may not be necessary, potentially reducing off-target effects

  • Targeted delivery approaches:

    • The predominant expression of Ifi27l2a in microglia suggests that microglia-targeted therapeutic delivery strategies might be particularly effective

    • The successful use of Cx3cr1-driven lentiviral constructs demonstrates the feasibility of cell-specific targeting

The authors explicitly note the therapeutic potential: "These findings... provide support for the therapeutic strategy of disrupting Ifi27l2a to attenuate inflammation in the post-stroke brain." Further research is needed to develop specific Ifi27l2a modulators and evaluate their efficacy and safety in preclinical and clinical settings.

How does mouse Ifi27l2a compare to its human ortholog in terms of structure and function?

While the search results don't provide comprehensive information about the human ortholog of Ifi27l2a, they do contain some relevant information about human studies:

  • Human microglial cell line studies:

    • The researchers used HMC3 human microglial cells treated with TNFα, IFNγ, and oxygen-glucose deprivation (OGD) to model stroke conditions

    • These cells showed induction of IFI27L2 (the human ortholog) in response to stimulation

    • This suggests functional conservation between mouse and human orthologs in terms of regulation by inflammatory stimuli

  • Human brain tissue analysis:

    • The study mentions analysis of "human autopsy brain samples" which demonstrated that "induction of Ifi27l2a occurs in microglia in response to aging, ischemic stroke, and pro-inflammatory molecules"

    • This suggests that the human ortholog is similarly regulated in pathological conditions

Based on these limited findings and general principles of evolutionary conservation, we can infer:

  • The basic inflammatory regulatory function appears to be conserved between mouse Ifi27l2a and human IFI27L2

  • Both are induced by similar stimuli (pro-inflammatory cytokines, ischemia)

  • Both may play roles in neuroinflammatory processes

  • Structural similarities or differences between mouse Ifi27l2a and human IFI27L2

  • Potential differences in expression patterns across brain regions or cell types

  • Whether the therapeutic effects of targeting Ifi27l2a would translate to humans

Further comparative studies would be needed to fully characterize the similarities and differences between mouse Ifi27l2a and human IFI27L2 to better assess translational potential.

What are the key unanswered questions about Ifi27l2a function in neuroinflammation?

Despite significant advances in understanding Ifi27l2a's role in neuroinflammation, several important questions remain unanswered:

  • Molecular mechanisms:

    • How does Ifi27l2a precisely induce mitochondrial dysfunction and ROS production?

    • What are the direct molecular targets or interaction partners of Ifi27l2a?

    • What signaling pathways mediate Ifi27l2a's effects on inflammatory gene expression?

  • Cell-type specific roles:

    • While the current research focuses on microglia, what roles might Ifi27l2a play in other CNS cell types?

    • Do different microglial subtypes respond differently to Ifi27l2a manipulation?

    • How do Ifi27l2a-expressing microglia interact with other CNS cells in the inflammatory cascade?

  • Temporal dynamics:

    • What is the time course of Ifi27l2a upregulation following stroke and how does it relate to the progression of injury?

    • Is there a critical window for therapeutic intervention targeting Ifi27l2a?

    • The study acknowledges the limitation of using "a single time point (14 post-stroke day) for evaluation"

  • Therapeutic targeting:

    • What are the most effective approaches for targeting Ifi27l2a (e.g., antisense oligonucleotides, small molecule inhibitors)?

    • Would CNS-specific Ifi27l2a targeting avoid potential systemic effects on viral defense?

    • What are the long-term consequences of Ifi27l2a inhibition?

  • Broader disease relevance:

    • Beyond stroke, what role might Ifi27l2a play in other neurodegenerative or neuroinflammatory conditions?

    • Given its upregulation with aging, does Ifi27l2a contribute to age-related cognitive decline?

    • The research mentions that "Ifi27l2a is upregulated in DAMs in other neurodegenerative diseases, such as Alzheimer's Disease"

Addressing these questions will require diverse experimental approaches, including:

  • Proteomic analysis to identify Ifi27l2a interaction partners

  • Temporal analysis of Ifi27l2a expression across the stroke recovery timeline

  • Application of Ifi27l2a modulation in diverse disease models

  • Development and testing of targeted therapeutic approaches

What methodological advances would facilitate further research on Ifi27l2a?

Several methodological advances would significantly enhance research on Ifi27l2a and its role in neuroinflammation:

  • Conditional and inducible genetic models:

    • Development of cell-type specific and temporally controlled Ifi27l2a knockout or overexpression models

    • This would allow more precise dissection of Ifi27l2a's role in specific cell populations and at different disease stages

    • Current research used global heterozygous knockouts, limiting cell-specific insights

  • Live imaging of Ifi27l2a activity:

    • Development of reporter systems to visualize Ifi27l2a expression and activity in real-time

    • This would enable tracking of dynamic changes in Ifi27l2a expression following stroke or other insults

    • Could be combined with intravital microscopy for in vivo visualization

  • High-throughput screening for Ifi27l2a modulators:

    • Development of assays suitable for screening compound libraries for molecules that inhibit Ifi27l2a expression or function

    • Would accelerate development of potential therapeutic agents

  • Spatial transcriptomics integration:

    • Combining single-cell RNA sequencing with spatial information would provide insights into regional variation in Ifi27l2a expression

    • Would help understand how Ifi27l2a-expressing cells are distributed relative to injury sites

  • Multi-omics approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data would provide a more comprehensive understanding of Ifi27l2a's effects

    • Could help identify downstream effectors and potential biomarkers

  • Translational models:

    • Development of humanized mouse models or improved human cell models would enhance translational relevance

    • The current research used HMC3 cells, but more physiologically relevant human models would be valuable

  • Long-term functional assessment:

    • More comprehensive and longer-term behavioral testing would better characterize the functional benefits of Ifi27l2a modulation

    • Current research assessed outcomes through 1-2 weeks post-stroke, but longer follow-up would be valuable

These methodological advances would address key limitations noted by the researchers, including "the relatively low number of biological samples and the use of a single time point (14 post-stroke day) for evaluation" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.