Recombinant Mouse Interferon alpha-inducible protein 27-like protein 2B (Ifi27l2b)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Characterization

Ifi27l2b, also known by alternative names including 1810023F06Rik and ISG12(b2), belongs to the IFI6/IFI27 family of proteins . Located on chromosome 12 in the mouse genome, this gene encodes a protein that functions within the interferon response pathway . The gene has been assigned the ID 217845 in the National Center for Biotechnology Information (NCBI) database, with RefSeq accession number BC021795 and UniGene ID Mm.298416 .

Protein Structure and Properties

The Ifi27l2b gene contains an open reading frame (ORF) of 852 base pairs that translates into a protein of 283 amino acids . Like other members of the ISG12 family, it contains a conserved ISG12 motif, which is characteristic of interferon-inducible proteins . The protein functions in intrinsic apoptotic signaling pathways and demonstrates interferon-induced antiviral activity .

Table 1: Key Molecular Features of Mouse Ifi27l2b

FeatureDescription
Gene SymbolIfi27l2b
Gene Synonyms1810023F06Rik; ISG12(b2)
SpeciesMouse (Mus musculus)
Chromosome LocationChromosome 12
Gene ID217845
ORF Size852 bp
Protein Length283 amino acids
Protein FamilyIFI6/IFI27 family
UniGene IDMm.298416
RefSeq AccessionBC021795

Expression and Regulation

Ifi27l2b is classified as an interferon-stimulated gene, with its expression primarily regulated by type I interferons . Research has shown that mouse Ifi27l2b responds to interferon stimulation in fibroblast cell lines, demonstrating the protein's role in the interferon response pathway .

Tissue Distribution

While specific data on Ifi27l2b tissue distribution is limited, studies on related family members suggest these proteins may be expressed in various tissues, with particular relevance in immune and central nervous system cells . The protein's expression pattern likely varies depending on the inflammatory status of the tissue, with upregulation occurring during viral infections or other inflammatory stimuli .

Role in Apoptotic Signaling

Functional analyses indicate that Ifi27l2b participates in the intrinsic apoptotic signaling pathway . This function may be particularly relevant during viral infections, where regulated cell death can be a critical defense mechanism to limit viral replication and spread .

Relationship to Ifi27l2a

Ifi27l2b shares significant homology with Ifi27l2a, another mouse interferon-inducible protein that has been more extensively characterized . Recent studies have identified Ifi27l2a as a novel gene regulator of neuroinflammation, particularly in the context of aging and ischemic stroke . Single-cell RNA sequencing revealed that Ifi27l2a is significantly upregulated in microglia following stroke, with this effect enhanced by aging .

Human Counterparts

The human ortholog of the mouse Ifi27 family is IFI27, located on chromosome 14 . While mouse has two Isg12b genes (Isg12b1 and Isg12b2), encoding proteins of different lengths, humans appear to have a single IFI27L2 gene . Interestingly, while mouse Isg12b responds robustly to interferon in fibroblast cell lines, human ISG12B showed limited interferon induction despite the presence of a putative interferon-stimulated response element .

Table 2: Comparison of Mouse and Human IFI27 Family Members

FeatureMouse Ifi27l2bMouse Ifi27l2aHuman IFI27L2
Chromosome12Not specified in sources14
Protein Length283 aaNot fully specified130 aa
Response to IFNResponsiveResponsiveLimited response
Known FunctionsApoptotic signaling, antiviralNeuroinflammation regulation, antiviralSimilar to mouse counterparts

Recombinant Protein Applications

Recombinant mouse Ifi27l2b protein serves as a valuable tool for investigating interferon-mediated immune responses . These proteins can be utilized in various experimental setups to study the protein's interactions, signaling pathways, and functional effects in different cellular contexts.

Viral Vector Systems

Adenovirus vectors expressing mouse Ifi27l2b (Ad-m-IFI27L2B) provide an efficient system for overexpressing the protein in experimental settings . These vectors typically use a CMV promoter for robust expression and can be designed with optional reporter genes such as GFP, CFP, YFP, RFP, or mCherry to facilitate detection and visualization .

Gene Manipulation Tools

Small interfering RNA (siRNA) targeting Ifi27l2b offers a method for investigating the protein's function through gene knockdown approaches . These siRNAs interfere with Ifi27l2b expression by degrading mRNA after transcription, preventing translation and effectively reducing protein levels .

Table 3: Research Tools for Studying Ifi27l2b

Tool TypeExamplesApplications
Recombinant ProteinsPurified recombinant Ifi27l2bProtein interaction studies, antibody production, functional assays
Viral VectorsAd-m-IFI27L2B, AAV-m-IFI27L2BOverexpression studies, in vivo gene delivery
RNA InterferencesiRNA against Ifi27l2bGene knockdown studies, loss-of-function analysis
Knockout ModelsIfi27l2b knockout miceIn vivo functional studies, disease models

Evolutionary Perspectives

The evolution of interferon-inducible genes provides insights into host-pathogen co-evolution. Studies on related proteins suggest that IFI27 family genes have undergone duplication and specialization events throughout mammalian evolution . This evolutionary history may explain functional differences between family members and their species-specific roles in antiviral defense .

In rodents, there appears to have been duplication of Ifi27-like genes, potentially enhancing defenses against specific viral threats . These evolutionary adaptations reflect the ongoing arms race between hosts and pathogens, where viruses continuously evolve mechanisms to mask their RNAs with "self" features, and hosts respond by diversifying their recognition and defense mechanisms .

Implications in Viral Infections

Understanding the function of Ifi27l2b in antiviral defense has implications for comprehending host responses to viral pathogens . Related family member Ifi27l2a has demonstrated protective effects against West Nile virus infection specifically in the central nervous system, suggesting that this protein family plays a role in neurotropic viral defense .

Future Research Directions

Several promising avenues for future research on Ifi27l2b include:

  1. Detailed structural characterization to elucidate molecular mechanisms of action

  2. Comparative functional studies between Ifi27l2b and Ifi27l2a to determine unique and overlapping roles

  3. Investigation of Ifi27l2b expression patterns in different disease models, particularly viral infections

  4. Exploration of potential therapeutic applications targeting Ifi27l2b in inflammatory and infectious conditions

  5. Development of improved recombinant protein variants with enhanced stability or functionality for research applications

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ifi27l2b; Isg12(b2); Interferon alpha-inducible protein 27-like protein 2B; Interferon-stimulated gene 12 protein B2; ISG12(b2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-283
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Ifi27l2b
Target Protein Sequence
AVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGVLGLSTITNIILVAVGT ATGARAEGSMGASREQESGPQDPPQELQEPQEPPSCKKQDLNLGKFVGAAIGGALAVAGA PIALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGILGLSTSTNIIL GAVGAATGATAAGAMGACREQEPGLQDLQQEPKEPQEPQELQKQQEPQEPQELQKQQETQ ETQETQELQKTQEPPSYEK
Uniprot No.

Target Background

Function
Ifi27l2b functions in the intrinsic apoptotic signaling pathway and may exhibit interferon-induced antiviral activity.
Gene References Into Functions
  1. ISG12b2, a novel IMM protein induced by IFNs, regulates mitochondria-mediated apoptosis during viral infection. PMID: 21151029
Database Links

KEGG: mmu:217845

UniGene: Mm.298416

Protein Families
IFI6/IFI27 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Ifi27l2b and how does it relate to other members of the Ifi27 family?

Ifi27l2b (Interferon alpha-inducible protein 27-like protein 2B) belongs to the Ifi27 gene family, which includes several interferon-stimulated genes (ISGs) induced during viral infections and inflammatory conditions. This family is comprised of several related proteins including Ifi27 (the prototypical member), Ifi27l1, Ifi27l2a, and Ifi27l2b. These proteins share structural similarities, including transmembrane domains and interferon-response elements in their promoter regions.

Ifi27l2b shows significant homology to Ifi27l2a, which has been characterized as an interferon-stimulated gene involved in neuroinflammation and stroke pathology . Like other family members, Ifi27l2b is induced by type I interferons as part of the innate immune response. The Ifi27 family members are relatively small proteins that can influence cellular functions despite their compact size, with Ifi27l2a having a theoretical molecular weight of approximately 7.3 kDa .

Structurally, these proteins contain hydrophobic regions that allow membrane association, which may be critical for their biological functions. Research on Ifi27 has shown it contains RNA-binding motifs (amino acids 60-65, 68, 69, and 82-86 in human IFI27), suggesting Ifi27l2b may possess similar functional domains .

What expression patterns characterize Ifi27l2b in different tissues and disease states?

Ifi27l2b expression patterns follow the general characteristics observed with other family members, with some tissue-specific variations. While specific data on Ifi27l2b is limited in the provided studies, research on related family members provides important insights:

  • Basal expression: Under normal physiological conditions, Ifi27l2b maintains low basal expression in most tissues, with potential tissue-specific differences.

  • Interferon induction: Ifi27l2b expression is significantly upregulated following type I interferon stimulation, consistent with its role as an interferon-stimulated gene.

  • Age-dependent expression: Research on the related Ifi27l2a shows increased expression in aged microglia compared to young microglia, suggesting potential age-related regulatory mechanisms that may also apply to Ifi27l2b .

  • Disease-associated upregulation: The Ifi27 family shows marked upregulation in various inflammatory conditions. For example, IFI27 expression increases significantly during viral infections like HIV-1 and HIV-2 , while Ifi27l2a is upregulated in microglia following ischemic stroke .

  • Cell type specificity: Evidence from single-cell RNA sequencing of brain tissue indicates that Ifi27l2a shows cell-type specific expression patterns, with particular enrichment in microglia during inflammatory conditions , suggesting Ifi27l2b may also show cell-type specific expression patterns.

  • Correlation with disease severity: IFI27 expression levels correlate with disease severity in chronic viral infections, with higher expression observed in more severe cases of HIV-1 compared to HIV-2 .

What methods are most effective for detecting and measuring Ifi27l2b expression?

Several complementary approaches can be employed to effectively detect and measure Ifi27l2b expression:

Quantitative RT-PCR (qRT-PCR)

  • Most commonly used method for quantifying Ifi27l2b mRNA expression

  • Requires careful primer design to distinguish between closely related family members

  • Essential to normalize to appropriate housekeeping genes that remain stable during inflammatory conditions

Single-cell RNA sequencing (scRNA-seq)

  • Allows analysis of Ifi27l2b expression at single-cell resolution

  • Particularly valuable for understanding cell-type specific expression patterns

  • Successfully used to identify Ifi27l2a upregulation in microglia following stroke

In situ hybridization

  • Enables visualization of Ifi27l2b mRNA in tissue sections

  • RNAscope technology provides enhanced sensitivity for low-abundance transcripts

  • Allows co-localization with cell-type specific markers

Western blotting

  • For protein-level detection using specific antibodies

  • Often challenging due to the small size of Ifi27 family proteins

  • May require epitope tagging (e.g., HA-tag) for reliable detection

Immunohistochemistry/Immunofluorescence

  • For spatial localization of Ifi27l2b in tissues

  • May require validation of antibody specificity

  • Can be combined with cell-type markers for co-localization studies

Recombinant protein expression systems

  • E. coli expression systems can produce purified recombinant protein

  • Useful for generating antibodies and performing biochemical studies

Researchers should implement multiple detection methods for comprehensive analysis and validation of Ifi27l2b expression, particularly when studying its role in complex disease processes.

How does Ifi27l2b contribute to interferon response pathways?

Based on studies of related family members, Ifi27l2b likely plays an important regulatory role in interferon response pathways:

Modulation of interferon signaling: Research on other family members suggests Ifi27l2b may function as a negative regulator of interferon responses. Human IFI27 has been shown to downregulate expression of interferon-stimulated genes (ISGs) and pro-inflammatory cytokines following viral infection or poly(I:C) stimulation .

RNA-binding capabilities: IFI27 can bind dsRNA analogs like poly(I:C), suggesting it may directly interact with viral RNAs to modulate immune responses . Ifi27l2b likely shares this capacity given sequence similarities.

Balance between protective and pathological responses: The Ifi27 family appears to help balance beneficial antiviral responses against excessive inflammation. While initially induced by interferons, these proteins may subsequently function to prevent hyperactivation of inflammatory pathways .

The potential regulatory mechanism is illustrated in the following pathway model:

StepInterferon Response PathwayIfi27l2b Role
1Viral infection/PAMP detectionTrigger for pathway activation
2Type I IFN productionUpstream inducer of Ifi27l2b
3IFN receptor signalingActivates Ifi27l2b transcription
4ISG induction (including Ifi27l2b)Ifi27l2b expression increases
5RNA binding by Ifi27l2bSequesters viral or cellular RNAs
6Attenuation of inflammatory mediatorsReduced expression of IL-1β, CXCL10, and other inflammatory factors

This negative feedback loop helps prevent excessive inflammation while maintaining sufficient antiviral protection. Experimental evidence shows that knockdown of IFI27 results in increased expression of IFIT2, IFNL1, and CXCL10 following viral infection , suggesting Ifi27l2b may exert similar regulatory effects.

What experimental approaches are most effective for investigating Ifi27l2b function in neuroinflammation?

Investigating Ifi27l2b in neuroinflammation requires a multi-faceted experimental approach:

In vitro models:

  • Microglial cell cultures: Primary microglial cultures or cell lines (e.g., SIM-A9) can be used to study Ifi27l2b function following inflammatory stimuli. Lentiviral vectors can drive expression of Ifi27l2b in microglia via the Cx3cr1 promoter, as demonstrated with Ifi27l2a .

  • Inflammatory challenges: Use LPS, poly(I:C), or cytokine cocktails to induce inflammatory responses. Measure changes in inflammatory markers (IL-1β, IL-1α, TNF-α) and cellular morphology via qRT-PCR and imaging .

  • ROS detection: Employ CellRox dye to measure reactive oxygen species production following Ifi27l2b overexpression or knockdown, as increased ROS production was observed with Ifi27l2a overexpression .

In vivo models:

  • Ischemic stroke models: The permanent distal middle cerebral artery occlusion (pdMCAO) model can assess Ifi27l2b's role in post-stroke inflammation and recovery. This approach successfully revealed Ifi27l2a's role in stroke pathology .

  • Hemizygous deletion models: Use heterozygous knockout mice (Ifi27l2b+/-) to evaluate effects of partial gene reduction, which has translational relevance for potential therapeutic approaches .

  • Single-cell transcriptomic analysis: Apply scRNA-seq to brain tissue from various experimental conditions to characterize cell-type specific Ifi27l2b expression patterns and responses to inflammatory stimuli .

Methodological workflow for neuroinflammation studies:

PhaseExperimental ApproachExpected OutcomesConsiderations
1. Expression AnalysisscRNA-seq of brain tissue from young vs. aged mice; normal vs. stroke conditionsCell-type specific expression patterns; temporal dynamicsInclude multiple time points post-stroke
2. Functional InvestigationLentiviral overexpression in microglia; siRNA knockdown; CRISPR-Cas9 editingEffects on inflammatory markers, ROS production, morphologyUse multiple cell lines to confirm findings
3. In vivo ValidationStroke induction in Ifi27l2b+/- mice; behavioral assessment; histological analysisImpact on infarct size, gliosis, functional recoveryAssess both acute and chronic phases
4. Mechanism ElucidationRNA-binding assays; proteomics; subcellular localizationMolecular interactions; signaling pathwaysConsider mitochondrial associations

This comprehensive approach should yield insights into Ifi27l2b's role in neuroinflammatory processes and potential as a therapeutic target.

How can researchers effectively manipulate Ifi27l2b expression in experimental systems?

Researchers have several options for manipulating Ifi27l2b expression, each with distinct advantages depending on the experimental context:

Overexpression systems:

  • Lentiviral vectors: Effective for both in vitro and in vivo overexpression. Cell-type specific promoters (e.g., Cx3cr1 for microglia) can target expression to relevant populations. This approach was successfully used for Ifi27l2a with observable phenotypic changes in microglial morphology and inflammatory profiles .

  • Plasmid transfection: Transient overexpression can be achieved using pCAGGS or similar expression vectors. Addition of epitope tags (e.g., HA-tag) facilitates detection and immunoprecipitation studies .

  • Inducible expression systems: Tet-On/Off systems allow temporal control of Ifi27l2b expression, important for studying dynamic processes.

Knockdown/knockout approaches:

  • siRNA-mediated knockdown: Effective for transient reduction of Ifi27l2b. Studies with IFI27 showed that siRNA knockdown increased expression of inflammatory genes following stimulation .

  • Hemizygous knockout mice: Ifi27l2b+/- mice provide a model of partial gene reduction that has translational relevance. Studies with Ifi27l2a+/- mice showed attenuated inflammatory responses and reduced brain injury after stroke .

  • Complete knockout mice: Ifi27l2b-/- models can reveal phenotypes related to complete loss of function.

  • CRISPR-Cas9 genome editing: Allows generation of cell lines or animal models with precise modifications to Ifi27l2b.

Stimulation of endogenous expression:

  • Interferon treatment: Type I interferons (IFN-α, IFN-β) can be used to induce endogenous Ifi27l2b expression.

  • Poly(I:C) stimulation: This dsRNA analog induces interferon responses and subsequent Ifi27l2b expression .

  • Viral infection models: Influenza virus, SARS-CoV-2, or Sendai virus infection triggers robust interferon responses and Ifi27 family gene expression .

Experimental considerations:

ApproachAdvantagesLimitationsTechnical Considerations
Lentiviral overexpressionCell-type specificity; stable expressionPotential insertional mutagenesisInclude reporter gene (e.g., eGFP) for monitoring
siRNA knockdownRapid implementation; cost-effectiveTransient; potential off-target effectsUse multiple siRNA sequences to confirm specificity
CRISPR-Cas9 knockoutComplete elimination of proteinPotential compensatory mechanismsVerify disruption by sequencing and protein detection
Hemizygous modelsMore physiologically relevantIncomplete elimination; potential variabilityConfirm ~50% reduction in expression levels
Inducible systemsTemporal controlSystem leakiness; more complex setupInclude appropriate controls for inducer effects

The choice of manipulation approach should align with specific research questions and experimental systems being utilized.

What are the emerging connections between Ifi27l2b and disease pathogenesis?

While specific data on Ifi27l2b remains limited in the provided research, studies on related family members highlight several emerging disease connections that may apply to Ifi27l2b:

Neuroinflammatory disorders:
Research on Ifi27l2a demonstrates a critical role in ischemic stroke pathology. Single-cell RNA sequencing revealed significant upregulation in aged microglia following stroke, with hemizygous deletion resulting in reduced gliosis, decreased brain injury, and improved functional recovery . This suggests Ifi27l2b may similarly influence neuroinflammatory processes in stroke and potentially other neurological conditions.

Viral infections:
IFI27 has been identified as a counterbalancing factor in innate immune responses to RNA viral infections. Studies demonstrate IFI27's ability to bind viral RNAs and modulate interferon responses during infection with influenza A virus (IAV) and SARS-CoV-2 . As a related family member, Ifi27l2b may play comparable roles in viral defense and pathogenesis in mice.

Chronic inflammatory conditions:
IFI27 expression is strongly linked to disease severity in chronic viral infections like HIV-1 and HIV-2, with higher expression correlating with more severe disease progression . This suggests Ifi27l2b may serve as both a biomarker and functional contributor to chronic inflammatory diseases.

Age-related inflammation:
Studies demonstrate increased expression of Ifi27l2a in aged brains compared to young brains , suggesting Ifi27l2b may similarly contribute to age-related inflammatory processes and potentially age-related diseases.

Disease-specific expression patterns:

Disease ContextExpression PatternPotential Functional SignificanceReference
Viral infectionUpregulated following infectionCounterbalances excessive inflammation
Ischemic strokeIncreased in microglia post-strokePromotes pro-inflammatory microglial phenotype
AgingElevated in aged tissuesContributes to age-related inflammatory changes
Chronic infectionCorrelates with disease severityPotential biomarker for disease progression

The dual role of Ifi27 family members in both promoting and regulating inflammation makes understanding Ifi27l2b's specific contributions to disease pathogenesis a complex but potentially valuable area for therapeutic development.

How do post-translational modifications affect Ifi27l2b function?

While specific data on Ifi27l2b post-translational modifications (PTMs) is not directly addressed in the provided research, several hypotheses can be formed based on structural and functional characteristics of the Ifi27 family:

Potential PTMs affecting Ifi27l2b function:

  • Phosphorylation: As a protein involved in signaling pathways, Ifi27l2b likely contains phosphorylation sites that regulate its activity or interactions. Protein kinases activated during inflammatory responses may target these sites to modulate Ifi27l2b function.

  • Ubiquitination: Many interferon-stimulated proteins undergo ubiquitin-mediated regulation. Ubiquitination may control Ifi27l2b stability, localization, or protein-protein interactions.

  • SUMOylation: This modification often regulates nuclear-cytoplasmic shuttling and transcriptional activities of proteins. If Ifi27l2b has nuclear functions, SUMOylation could be a critical regulatory mechanism.

  • Lipid modifications: Given the membrane association of Ifi27 family proteins, lipid modifications such as palmitoylation may regulate their membrane localization and function.

Experimental approaches to investigate PTMs:

ApproachMethodologyExpected OutcomesTechnical Considerations
Mass spectrometryLC-MS/MS analysis of purified Ifi27l2bIdentification of modification sites and typesRequires optimization for small proteins
MutagenesisSite-directed mutagenesis of predicted modification sitesFunctional consequences of preventing specific PTMsCreate comprehensive panel of mutants
Pharmacological inhibitionTreatment with kinase, phosphatase, or deubiquitinase inhibitorsEffects on Ifi27l2b stability, localization, or functionConsider pathway specificity and off-target effects
ImmunoprecipitationPull-down with PTM-specific antibodiesDetection of modified Ifi27l2b speciesMay require epitope-tagged constructs

Potential functional consequences of PTMs:

  • Altered RNA-binding capacity: Modifications near the RNA-binding domain could enhance or inhibit interactions with viral RNAs or regulatory RNAs .

  • Changed subcellular localization: PTMs might regulate trafficking between membrane compartments, cytoplasm, and possibly the nucleus.

  • Modified protein stability: Ubiquitination or other modifications could alter protein half-life, affecting the duration of Ifi27l2b activity during immune responses.

  • Regulated protein-protein interactions: PTMs often create or disrupt binding interfaces, potentially affecting Ifi27l2b's interactions with signaling complexes.

Understanding these regulatory mechanisms would provide insights into how Ifi27l2b function is fine-tuned during different phases of immune responses and inflammatory conditions.

What therapeutic strategies could target Ifi27l2b for treating inflammatory diseases?

Based on research findings with Ifi27 family members, several promising therapeutic strategies targeting Ifi27l2b could be developed for inflammatory diseases:

Antisense oligonucleotide (ASO) approach:
Research with Ifi27l2a hemizygous mice demonstrated that even partial reduction (~50%) of gene expression significantly attenuated neuroinflammation and reduced brain injury after ischemic stroke . This suggests antisense oligonucleotides targeting Ifi27l2b mRNA could provide therapeutic benefits while maintaining some baseline function.

Small molecule inhibitors:
Identification of small molecules that interfere with Ifi27l2b's RNA-binding capacity could modulate its regulatory functions. Since studies show IFI27 can bind dsRNA (poly(I:C)) , compounds that compete for RNA binding or alter the protein's conformation could be therapeutically valuable.

Peptide-based approaches:
Developing peptides that mimic critical binding interfaces could disrupt protein-protein interactions essential for Ifi27l2b function. This approach offers potential specificity advantages over small molecules.

Cell-type specific targeting:
Delivery systems that target specific cell populations (e.g., microglia in neuroinflammatory conditions) could enhance therapeutic efficacy while minimizing off-target effects. Research shows Ifi27l2a upregulation is particularly prominent in microglia during aging and after stroke .

Disease contexts with therapeutic potential:

Disease ContextTherapeutic ApproachPotential BenefitsImplementation Considerations
Ischemic strokeASO-mediated partial knockdownReduced secondary inflammation; improved recoveryTime-sensitive administration window
Viral encephalitisModulation of RNA-binding activityBalanced antiviral defense without excessive inflammationMay require blood-brain barrier penetrance
Neurodegenerative diseasesMicroglia-targeted delivery of inhibitorsAttenuation of chronic neuroinflammationLong-term safety profile needed
Autoimmune disordersSystemic partial knockdownDampened pathological immune activationMaintain sufficient function for normal defense

Proof-of-concept evidence:
Research with Ifi27l2a heterozygous mice showed significant improvements following stroke, including:

  • Approximately 50% reduction in cortical infarct at 3 days post-stroke

  • Reduced brain atrophy at 30 days post-stroke

  • Decreased microgliosis in peri-infarct regions at 14 days post-stroke

  • Reduced astrogliosis and microgliosis in ipsilateral thalamus

  • Improved sensory-motor function through 1-2 weeks after stroke

These findings provide strong rationale for targeting Ifi27 family members, including Ifi27l2b, in inflammatory disease contexts. The partial reduction approach has particular translational relevance, as it suggests therapeutic benefits can be achieved without complete inhibition of protein function.

What are the critical quality control measures for recombinant Ifi27l2b production?

Producing high-quality recombinant Ifi27l2b requires rigorous quality control measures throughout the production process:

Expression system selection:
The E. coli expression system has been successfully used for producing recombinant Ifi27 family proteins . For Ifi27l2b, consider the following quality control parameters:

  • Expression vector design: Include appropriate tags (His-tag, GST, etc.) for purification and detection, while ensuring tags don't interfere with protein function.

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time to maximize soluble protein yield while minimizing inclusion body formation.

  • Protein solubility assessment: Evaluate distribution between soluble and insoluble fractions, as membrane-associated proteins like Ifi27l2b may have solubility challenges.

Purification quality controls:

Quality ParameterAssessment MethodAcceptance CriteriaTroubleshooting Approach
PuritySDS-PAGE; Silver staining>90% purity Additional purification steps
IdentityWestern blot; Mass spectrometryCorrect molecular weight; Sequence verificationAdjust expression constructs
Endotoxin levelsLAL assayLow endotoxin (<1 EU/μg protein)Endotoxin removal columns
Aggregation stateSize exclusion chromatographyPredominantly monomericBuffer optimization
Functional activityRNA-binding assaySpecific binding to target RNAsRefolding protocols if needed

Storage and stability:
Monitor stability under various storage conditions (temperature, buffer composition, freeze-thaw cycles) to establish optimal preservation methods. Determine shelf-life under recommended storage conditions.

Batch consistency:
Implement lot-to-lot comparison to ensure consistent biochemical and functional properties between production batches.

Application-specific validations:
For cell culture applications, confirm the recombinant protein is free of microbial contamination and cytotoxic components. For in vivo applications, additional sterility testing and endotoxin removal may be required .

These quality control measures ensure that experimental outcomes with recombinant Ifi27l2b are reliable and reproducible across studies.

How can researchers overcome challenges in distinguishing between Ifi27 family members?

Distinguishing between closely related Ifi27 family members presents significant challenges for researchers. Here are effective strategies to overcome these obstacles:

Nucleic acid level discrimination:

  • Primer design for qRT-PCR:

    • Target unique exon junctions or regions of sequence divergence

    • Validate primer specificity against plasmids containing each family member

    • Perform melt curve analysis to confirm single amplicon

    • Include negative controls in tissues where specific family members are not expressed

  • RNAscope in situ hybridization:

    • Design probes targeting unique regions

    • Include positive controls for each family member

    • Perform dual hybridization with probes for different family members to confirm specificity

  • CRISPR-based tagging:

    • Introduce unique epitope tags to endogenous genes

    • Enables specific detection while maintaining natural expression regulation

Protein level discrimination:

  • Custom antibody development:

    • Generate antibodies against unique peptide regions

    • Extensive validation using overexpression and knockout controls

    • Cross-adsorption against other family members to remove cross-reactive antibodies

  • Mass spectrometry approaches:

    • Identify unique peptides for each family member

    • Develop targeted MS assays (MRM/PRM) for specific detection

    • Quantify family members based on unique peptide signatures

Functional discrimination:

  • Family member-specific knockdown:

    • Use siRNAs targeting unique regions

    • Validate knockdown specificity by measuring all family members

    • Assess functional outcomes to determine specific contributions

  • Rescue experiments:

    • Knockdown endogenous expression of all family members

    • Perform selective rescue with individual family members

    • Evaluate which phenotypes are restored by which family member

Comparative analysis framework:

ApproachAdvantagesLimitationsValidation Method
qRT-PCR with specific primersHigh sensitivity; quantitativeRNA only; potential cross-reactivityTest against overexpression constructs of each family member
Custom antibodiesProtein detection; spatial informationDevelopment time; potential cross-reactivityWestern blot validation with knockout controls
MS-based proteomicsUnambiguous identification; quantitativeSample preparation complexity; equipment accessSpike-in of recombinant proteins as standards
CRISPR taggingEndogenous regulation; specific detectionLabor intensive; potential functional impactConfirm normal expression patterns and function

By implementing these strategies, researchers can confidently distinguish between Ifi27l2b and other family members, enabling accurate attribution of biological functions to specific proteins.

What are the emerging research questions about Ifi27l2b that remain to be addressed?

Several critical knowledge gaps and emerging research questions about Ifi27l2b warrant further investigation:

Molecular mechanisms:

  • What are the precise RNA targets of Ifi27l2b, and how does binding specificity determine its function?

  • Does Ifi27l2b form complexes with other proteins to exert its regulatory effects?

  • What is the subcellular localization of Ifi27l2b, and how does this change during immune responses?

  • What post-translational modifications regulate Ifi27l2b activity?

Physiological roles:

  • How does Ifi27l2b expression differ across tissues and cell types under homeostatic conditions?

  • What are the unique and redundant functions among Ifi27 family members?

  • Does Ifi27l2b have functions beyond immune regulation (e.g., metabolism, development)?

  • What are the consequences of complete Ifi27l2b deficiency versus partial reduction?

Disease relevance:

  • How does Ifi27l2b contribute to age-related inflammatory conditions?

  • What is the role of Ifi27l2b in viral pathogenesis beyond acute inflammation?

  • Does Ifi27l2b influence microglial activation states in neurodegenerative diseases?

  • Can Ifi27l2b serve as a biomarker for disease severity or treatment response?

Therapeutic potential:

  • Can targeted modulation of Ifi27l2b provide therapeutic benefits without compromising host defense?

  • What is the optimal degree of Ifi27l2b inhibition for therapeutic purposes?

  • How can Ifi27l2b-targeted therapies be delivered to specific cell populations?

  • Are there natural compounds that modulate Ifi27l2b function?

Research on related family members provides important context for these questions. Studies show that Ifi27l2a plays a significant role in neuroinflammation following stroke , and IFI27 modulates innate immune responses during viral infections by binding RNA and attenuating inflammatory gene expression . Similarly, IFI27 expression correlates with disease severity in HIV infection . These findings suggest Ifi27l2b likely has important roles in inflammatory regulation that merit detailed investigation.

How might advanced technologies enhance our understanding of Ifi27l2b biology?

Advanced technologies offer promising approaches to unravel Ifi27l2b biology in unprecedented detail:

Single-cell multi-omics:
Single-cell RNA sequencing has already revealed important insights about Ifi27l2a expression in different brain cell populations after stroke . Extending this to multi-omic approaches could provide comprehensive understanding of Ifi27l2b:

  • Single-cell RNA + protein profiling: Simultaneous measurement of Ifi27l2b transcript and protein levels at single-cell resolution.

  • Spatial transcriptomics: Mapping Ifi27l2b expression patterns within tissue architecture to understand microenvironmental influences.

  • Single-cell ATAC-seq: Identifying chromatin accessibility changes that regulate Ifi27l2b expression in different cell states.

Advanced structural biology:

  • Cryo-EM: Determine the three-dimensional structure of Ifi27l2b alone and in complex with RNA or protein partners.

  • Hydrogen-deuterium exchange mass spectrometry: Map conformational changes upon RNA binding or during protein interactions.

  • In-cell NMR: Characterize structural dynamics of Ifi27l2b in its native cellular environment.

Functional genomics and proteomics:

  • CRISPR screens: Identify genes that interact with Ifi27l2b using CRISPR activation or knockout approaches.

  • BioID or APEX proximity labeling: Map the Ifi27l2b interactome by identifying proteins in close proximity.

  • RNA interactome capture: Identify the complete set of RNAs bound by Ifi27l2b under different conditions.

  • Phosphoproteomics: Characterize changes in signaling networks following Ifi27l2b manipulation.

In vivo technologies:

  • Inducible, cell-type specific knockout models: Temporally and spatially controlled deletion of Ifi27l2b.

  • Intravital imaging: Real-time visualization of Ifi27l2b-expressing cells during inflammatory responses.

  • AAV-mediated gene transfer: Targeted delivery of Ifi27l2b modulators to specific tissues or cell types.

Computational approaches:

  • AI-driven protein structure prediction: Use AlphaFold or similar tools to predict Ifi27l2b structure and functional domains.

  • Network analysis: Integrate multi-omic data to position Ifi27l2b within cellular signaling networks.

  • Molecular dynamics simulations: Model Ifi27l2b interactions with RNAs or protein partners.

These technologies could significantly accelerate our understanding of Ifi27l2b biology and potential therapeutic applications. For example, single-cell approaches successfully identified Ifi27l2a as a key regulator of neuroinflammation , suggesting similar approaches could uncover important insights about Ifi27l2b in various disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.