Recombinant Mouse Interferon-induced transmembrane protein 10 (Ifitm10)

Shipped with Ice Packs
In Stock

Description

Introduction

Interferon-induced transmembrane protein 10 (IFITM10) is a highly conserved member of the IFITM protein family . The IFITM family is known for its antiviral properties, preventing viral infection early in the viral lifecycle . IFITM10 exists in aquatic and terrestrial forms, indicating that it may be associated with adaptation to different environments .

IFITM10 Gene Identification

A study identified 174 IFITM orthologous genes and 112 pseudogenes from 27 vertebrate genome sequences, dividing the vertebrate IFITM family into sub-families .

Expression and Induction

IP-10 mRNA expression can be induced in vitro and in vivo in glomerular and tubulointerstitial cells, suggesting its involvement in renal damage modulation in experimental nephrosis .

IFITM10 and Immune Function

IFITM10 expression is positively correlated with the expression levels of CD69, CD44, NKp30, and granzyme B, which are important for immune cell function . In patients recovering from COVID-19, IFITM10 expression levels are substantially higher than in patients with persistent viral shedding .

4.1. Correlation with ID1

IFITM10 expression is negatively correlated with ID1 expression, which is implicated in immune suppression .

IFITM10 and Viral Infections

IFITM proteins, including IFITM10, have demonstrated the ability to prevent viral infections during the early stages of viral lifecycles .

IFITM10 and Environmental Factors

Various compounds and conditions can affect IFITM10 expression :

  • Increased expression: Copper, Diquat, Esketamine, Hydrogen Peroxide, Ketamine, Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter

  • Decreased expression: DDE (Dichlorodiphenyl Dichloroethylene), Diisodecyl phthalate, Doxorubicin

IFITM10 in Chicken

In chickens, IFITM10 levels are significantly lower than IFITM3, an antiviral protein .

IP-10 and T Cell Responses

IP-10-deficient mice exhibit impaired T cell responses, characterized by decreased proliferation, reduced IFN-γ secretion, and impaired contact hypersensitivity responses .

8.1. IP-10 and Viral Replication

Mice lacking IP-10 show an impaired ability to control viral replication in the brain, which is associated with decreased recruitment of CD4+ and CD8+ lymphocytes, reduced levels of IFN-γ, and impaired generation of viral-specific CD8+ T cells .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Ifitm10; Interferon-induced transmembrane protein 10; Dispanin subfamily A member 3; DSPA3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ifitm10
Target Protein Sequence
MAQGPSQCPALLGAPASTTDGTQEARVPLDGAFWIPRPPAGSPKGCFACVSKPPALQAAA APAPEPSASPPMAPTLFPMESKSSKTDSVRASGVPQACKHLAEKKTMTNPTTVIEVYPDT TEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSS ALAASCIILIFIFLRYPLTDY
Uniprot No.

Target Background

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.