Recombinant Mouse Interferon-induced transmembrane protein 1 (Ifitm1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Interferon-induced Transmembrane Protein 1 (Ifitm1)

Recombinant mouse Interferon-induced Transmembrane Protein 1 (Ifitm1) is an engineered form of the endogenous Ifitm1 protein, a member of the interferon-stimulated gene (ISG) family. It is primarily expressed at the plasma membrane and plays a critical role in restricting viral entry and replication. Recombinant Ifitm1 is produced via heterologous expression systems (e.g., lentiviral vectors, bacterial systems) to study its antiviral mechanisms, structural properties, and therapeutic potential.

Protein Structure

Mouse Ifitm1 is a small transmembrane protein with:

  • 125 amino acids (homologous to human IFITM1) .

  • Two transmembrane domains flanking a conserved intracellular loop (CIL) critical for subcellular localization and antiviral activity .

  • Cytoplasmic N-terminal and extracellular C-terminal domains .

FeatureDescriptionSource
LocalizationPlasma membrane (confirmed by immunofluorescence and flow cytometry)
Key Functional DomainCIL domain mutations disrupt plasma membrane localization and antiviral activity
Molecular Weight~17 kDa (similar to human IFITM1)

Antiviral Mechanisms

Ifitm1 restricts viruses that enter via plasma membrane fusion:

  1. Electron Transport: Disrupts viral envelope fusion with host membranes.

  2. Receptor Competition: Binds to viral entry receptors (e.g., EphA2 in human studies) .

  3. Membrane Stiffening: Alters membrane fluidity to block viral fusogenic proteins.

Viral Infection Studies

Recombinant Ifitm1 has been used to study its role in restricting:

VirusObserved EffectModel SystemSource
Respiratory Syncytial Virus (RSV)~50% reduction in infection; increased severity in Ifitm1−/− miceVero cells, Mice
Herpes Simplex Virus 1 (HSV-1)Restricted entry in A549 cells (36.6% infection vs. 75.1% control)A549 cells
Mumps VirusInhibition confirmed via lentiviral overexpressionVero cells
Influenza A VirusSynergistic restriction with Ifitm3Vero cells

Cancer Research

While human IFITM1 is implicated in tumor progression, mouse studies show:

  • No Role in Germ Cell Migration or Somitogenesis: Ifitm1−/− mice exhibit normal fertility and embryonic development .

  • Lung Expression: Selective expression in bronchial epithelia, with overexpression linked to non-small cell lung cancers (NSCLC) in humans .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Ifitm1; Interferon-induced transmembrane protein 1; Dispanin subfamily A member 2a; DSPA2a; Fragilis protein 2; Mouse ifitm-like protein 2; Mil-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSV KSRDRKMVGDTTGAQAFASTAKCLNISSLFFTILTAIVVIVVCAIR
Uniprot No.

Target Background

Function
IFITM1 is an interferon-induced antiviral protein that inhibits viral entry into the host cell cytoplasm. It allows endocytosis but prevents subsequent viral fusion and release of viral contents into the cytosol. IFITM1 exhibits activity against various viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), and West Nile virus (WNV). It can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, and SARS-CoV S protein-mediated viral entry. IFITM1 also plays a role in cell adhesion, cell growth control, and cell migration. It acts as a key regulator in the antiproliferative action of IFN-gamma, either by inhibiting ERK activation or by arresting cell growth in the G1 phase in a p53-dependent manner. Additionally, IFITM1 acts as a positive regulator of osteoblast differentiation.
Gene References Into Functions
  1. Age-related onset of obesity correlates with metabolic dysregulation and altered microglia morphology in mice deficient for Ifitm proteins. PMID: 25856311
  2. The C-terminal region of IFITM1 plays a crucial role in modulating antiviral function by controlling protein subcellular localization. PMID: 25738301
  3. Palmitoylation of IFITM1 regulates protein stability by preventing proteasomal degradation. Modification of the nonconserved cysteine at the IFITM1 C terminus supports an intramembrane topology with implications for anti-influenza A virus activity. PMID: 23804635
  4. IFITM1 can function as a negative regulator of cell proliferation. Given its gene mapping to chromosome band 11p15.5, previously associated with NSCLC, it is likely that IFITM1 plays a key role in tumor formation in humans. PMID: 23115618
  5. Fragilis2 regulates epithelialization of the somites and paraxial mesoderm formation. PMID: 15857914
  6. The antiproliferative action of IFN-gamma requires the induction of IFITM1. PMID: 16847454

Show More

Hide All

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Lysosome membrane.
Tissue Specificity
Predominantly expressed in nascent primordial germ cells, as well as in gonadal germ cells.

Q&A

What is the fundamental role of Ifitm1 in cellular immunity?

Ifitm1 belongs to the interferon-stimulated gene (ISG) family and functions as a crucial component of the innate immune system. Unlike its family members IFITM2 and IFITM3 which primarily localize intracellularly, IFITM1 predominantly localizes to the plasma membrane where it plays a significant role in restricting viral entry . IFITM1 is involved in antiproliferative functions and immune surveillance, contributing to both antiviral defense and broader cellular processes including cell adhesion signal transduction in lymphocytes . In experimental systems, IFITM1 has demonstrated the ability to inhibit a range of viruses that enter via the plasma membrane, including members of the Paramyxoviridae and Pneumoviridae families, as well as certain DNA viruses like herpes simplex virus 1 (HSV-1) .

How does Ifitm1 expression differ from other IFITM family proteins?

While all IFITM proteins can be induced by type I interferons, their subcellular localization and specific functions differ significantly. IFITM1 primarily localizes to the plasma membrane, whereas IFITM2 and IFITM3 show predominant localization to late/early endosomes and lysosomes respectively . This differential localization contributes to their specialized antiviral activities. For instance, IFITM2 and IFITM3 primarily restrict viruses entering via endocytosis, targeting late entry stages, while IFITM1's plasma membrane localization enables it to restrict viruses that enter directly through the cell surface . Expression studies reveal that the conserved intracellular loop (CIL) domain contains amino acid sequences critical for determining IFITM1's subcellular localization, which directly impacts its antiviral function .

How does Ifitm1 mechanistically restrict viral infection compared to IFITM2/3?

IFITM1's mechanism of viral restriction differs from IFITM2/3 due to its distinct subcellular localization. While IFITM1 can interact directly with viral entry receptors like CD81 (as demonstrated in HCV studies), IFITM2 and IFITM3 target endocytosed virions for lysosomal degradation . Research shows that S-palmitoylation is essential for the anti-viral activity of all three IFITM proteins, whereas tyrosine phosphorylation plays differential roles. The conserved tyrosine residue in the N-terminal domain of IFITM2/3 is crucial for proper protein localization but is dispensable for anti-HCV activity . When this tyrosine is mutated in IFITM2/3, they adopt an IFITM1-like phenotype, maintaining anti-HCV activity while co-localizing with CD81 . This suggests that the IFITM proteins function coordinately but through distinct mechanisms to restrict viral infections at different stages of viral entry.

What is the role of Ifitm1 in epigenetic regulation and endogenous retrovirus suppression?

IFITM1 plays a significant role in epigenetic regulation, particularly in suppressing human endogenous retroviruses (HERVs) in human embryonic stem cells (hESCs). Studies using CRISPR/Cas9-mediated IFITM1 knockout in hESCs have demonstrated that while IFITM1 loss does not affect self-renewal, pluripotency, telomerase activity, or telomeres, it significantly increases HERV expression . Mechanistically, IFITM1 knockout results in reduced trimethylation of histone H3 on lysine 9 (H3K9me3) at HERV loci, indicating that IFITM1 suppresses HERVs through regulation of this specific epigenetic modification . This function represents a unique aspect of IFITM1 biology beyond its well-established antiviral activity and suggests potential roles in developmental processes and genomic stability that researchers should consider when studying IFITM1 in developmental contexts.

How is Ifitm1 involved in cancer progression and therapy resistance?

IFITM1 has emerged as a critical factor in cancer biology, particularly in endocrine-resistant breast cancer. Clinical studies have correlated IFITM1 expression with higher clinical stage and poor response to endocrine therapy in ER-positive breast tumors . Mechanistically, IFITM1 overexpression promotes an aggressive phenotype characterized by enhanced proliferation and invasion. In aromatase inhibitor (AI)-resistant breast cancer cells, IFITM1 is constitutively overexpressed compared to AI-sensitive cells . The JAK/STAT signaling pathway mediates this effect, as loss of IFITM1 markedly increases p21 transcription, expression, and nuclear localization through JAK/STAT activation . These findings indicate that IFITM1 overexpression contributes to therapy resistance by suppressing p21-mediated cell cycle arrest and apoptosis. Researchers investigating cancer therapy resistance should consider IFITM1 as a potential therapeutic target, particularly in endocrine-resistant disease models.

What are the optimal methods for detecting and quantifying Ifitm1 expression in experimental systems?

For reliable detection and quantification of Ifitm1, researchers should employ multiple complementary approaches. For protein-level detection, Western blotting using highly specific antibodies such as the IFITM1 (D5P5J) Rabbit mAb can be used at a 1:1000 dilution to detect the approximately 14 kDa Ifitm1 protein . Immunoprecipitation (1:200 dilution) and flow cytometry (1:3200 dilution for fixed/permeabilized cells) are also effective using the same antibody . For transcriptional analysis, quantitative real-time PCR (qRT-PCR) can be employed using IFITM1-specific primers. When designing experiments, it's important to note that interferon treatment significantly upregulates IFITM1 expression, with both interferon-α and -γ being potent inducers . Therefore, experimental conditions should be carefully controlled for interferon exposure. Additionally, including appropriate positive controls (interferon-stimulated cells) and negative controls (IFITM1 knockout cells) is essential for accurate interpretation of results.

What are the most effective in vivo models for studying Ifitm1 function?

Several in vivo models have proven valuable for investigating Ifitm1 function. The Ifitm1-/- knockout mouse provides a powerful tool for studying the physiological role of Ifitm1, particularly in viral infection models. Studies have demonstrated that Ifitm1-/- mice experience more severe respiratory syncytial virus (RSV) infection compared to wild-type mice, establishing Ifitm1's protective role against this pathogen . For cancer research, the orthotopic (mammary fat pad) and mouse mammary intraductal (MIND) models offer complementary approaches . The orthotopic model involves injecting cancer cells directly into the mammary fat pad to assess tumor growth, while the MIND model entails injection of cells into the mammary duct through the nipple, allowing cells to populate the duct and potentially invade surrounding tissue . The MIND model particularly excels in recreating the natural tumor microenvironment for studying ER+ breast cancer cell lines and more accurately reflects the behavior of primary breast cancer cells regarding aggression and therapy response .

How can researchers effectively manipulate Ifitm1 expression for functional studies?

For loss-of-function studies, researchers can employ several approaches with differing temporal and spatial precision. CRISPR/Cas9-mediated knockout provides complete and permanent elimination of Ifitm1 expression and has been successfully used in various cell types including human embryonic stem cells . For temporary knockdown, lentivirus-mediated shRNA delivery offers efficient suppression of Ifitm1 expression and has been validated in models such as AI-resistant breast cancer cells (MCF-7:5C), where it significantly reduced tumor growth and invasion while inducing cell death . For gain-of-function studies, overexpression of Ifitm1 using lentiviral vectors has demonstrated enhanced aggressive phenotypes in wild-type MCF-7 cells, promoting estrogen-independent growth . When designing these experiments, researchers should consider potential compensatory mechanisms by other IFITM family members and include appropriate controls examining expression of IFITM2 and IFITM3. Additionally, when creating stable cell lines expressing recombinant Ifitm1, selection with appropriate antibiotics (e.g., 3 μg/ml blasticidin) after lentiviral transduction can help establish polyclonal cell populations for experimental use .

How should researchers address contradictory findings regarding Ifitm1 function in different experimental systems?

Contradictory findings regarding Ifitm1 function often stem from context-dependent effects across different experimental systems. When faced with such contradictions, researchers should systematically evaluate several factors. First, cell type-specific effects are critical—IFITM proteins demonstrate cell type-specific functions, as evidenced by their differential antiviral activities in various cell lines . Second, localization differences significantly impact function—IFITM1's activity depends on its plasma membrane localization, which can vary between cell types and experimental conditions . Third, post-translational modifications like S-palmitoylation and tyrosine phosphorylation significantly alter IFITM1 function and should be assessed when comparing results across studies .

To reconcile contradictory findings, researchers should:

  • Directly compare IFITM1 subcellular localization across experimental systems using immunofluorescence

  • Assess expression levels quantitatively via Western blot and qRT-PCR

  • Evaluate post-translational modification status

  • Consider the activation state of interferon signaling pathways

  • Examine potential interactions with cell-specific factors

This systematic approach helps establish whether contradictions represent genuine biological variability or experimental inconsistencies.

What are the key considerations when analyzing Ifitm1 knockout phenotypes in mouse models?

When analyzing Ifitm1 knockout phenotypes in mouse models, researchers must address several complexities to ensure accurate data interpretation. First, functional redundancy among IFITM family members can mask phenotypes—IFITM2 and IFITM3 may compensate for IFITM1 loss in certain contexts, necessitating analysis of all family members' expression levels in knockout models . Second, phenotype penetrance often varies with infection type, as demonstrated by Ifitm1-/- mice showing more severe RSV infection but unaltered mCMV infection compared to wild-type mice .

For robust phenotypic analysis, researchers should:

  • Include comprehensive viral challenge panels when assessing antiviral functions

  • Monitor expression of other IFITM family members to detect compensatory upregulation

  • Assess phenotypes across multiple tissues, particularly those with high endogenous Ifitm1 expression

  • Consider the influence of mouse genetic background on phenotype manifestation

  • Examine age-dependent effects, as innate immune responses may vary throughout development

Additionally, when comparing results to IFITM3 knockout models, researchers should recognize that IFITM1 appears to have distinct antiviral activity, as evidenced by different outcomes in viral infection models .

What are the most promising therapeutic applications targeting Ifitm1 in disease models?

Based on current research, several therapeutic applications targeting Ifitm1 show significant promise. In endocrine-resistant breast cancer, inhibiting IFITM1 represents a compelling approach, as IFITM1 knockdown diminishes tumor growth and invasion while inducing cell death in AI-resistant models . The mechanistic link between IFITM1 inhibition and increased p21 expression through JAK/STAT signaling provides a molecular basis for this therapeutic strategy .

For viral infections, particularly those affecting the respiratory tract, enhancing IFITM1 expression or function might offer protective benefits, as evidenced by the increased severity of RSV infection in Ifitm1-/- mice . Researchers exploring this direction should investigate:

  • Small molecule stabilizers of IFITM1 that enhance its antiviral activity

  • Targeted delivery systems to increase IFITM1 expression in susceptible tissues

  • Compounds that promote IFITM1's optimal plasma membrane localization

  • Combination approaches targeting multiple IFITM proteins simultaneously

Additionally, the role of IFITM1 in suppressing endogenous retroviruses suggests potential applications in conditions associated with HERV activation, such as autoimmune disorders and certain neurological diseases . This represents an unexplored frontier with significant therapeutic potential.

What technological advances would enhance our understanding of Ifitm1 biology?

Several technological advances would substantially advance our understanding of Ifitm1 biology. High-resolution structural studies of IFITM proteins remain challenging due to their membrane-associated nature, but would provide crucial insights into their mechanism of action. Advanced live-cell imaging techniques that allow real-time visualization of IFITM1 during viral entry would help resolve questions about its precise mechanism of restriction.

Other valuable technological developments include:

  • CRISPR base editing systems for introducing specific polymorphisms identified in human IFITM1 to study their functional consequences

  • Physiologically relevant 3D culture systems (organoids) expressing variable levels of IFITM1 to better model tissue-specific functions

  • Improved methods for detecting and quantifying IFITM1 post-translational modifications in complex samples

  • Single-cell technologies to analyze heterogeneity in IFITM1 expression and function within tissues

  • Systems biology approaches integrating transcriptomic, proteomic, and functional data to identify novel IFITM1 interaction partners and regulatory networks

These technological advances would help resolve current knowledge gaps and potentially identify new therapeutic targets related to IFITM1 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.