Recombinant Mouse Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4)

Shipped with Ice Packs
In Stock

Description

Expression Systems

The production of high-quality recombinant mouse Kcnn4 protein requires suitable expression systems that ensure proper protein folding and post-translational modifications. Mammalian cell lines, particularly HEK-293 cells, are predominantly used for expressing recombinant mouse Kcnn4 proteins . This expression platform offers significant advantages over bacterial systems by providing appropriate cellular machinery for complex protein processing.

Purification Techniques

Recombinant mouse Kcnn4 is typically purified using one-step affinity chromatography methods that leverage the incorporated His-tag or other affinity tags . The purification process yields protein preparations with purity levels exceeding 90% as determined by Bis-Tris Page and Western Blot analyses . Commercial preparations of recombinant mouse Kcnn4 are available in different quantities, with varying concentrations to suit different research applications .

Physiological Functions

Kcnn4 channels mediate numerous critical physiological processes through their role in regulating membrane potential and cellular calcium signaling. These functions include:

  1. Regulation of cell volume homeostasis

  2. Modulation of membrane hyperpolarization following calcium influx

  3. Contribution to cellular proliferation and differentiation processes

  4. Involvement in immune cell activation and function

  5. Participation in epithelial ion transport mechanisms

Tissue Distribution and Expression Patterns

Based on published research concerning KCNN4 (the human ortholog), this channel protein exhibits widespread tissue distribution with particularly notable expression in:

  1. Blood tissues and cells (>130 publications)

  2. Brain (>35 publications)

  3. Lung (>31 publications)

  4. Intestine (>31 publications)

  5. Liver (>19 publications)

  6. Bone and bone marrow (>13 and >11 publications, respectively)

  7. Pancreas (>10 publications)

This widespread distribution underscores the protein's fundamental importance across multiple organ systems and physiological processes.

Experimental Applications

Recombinant mouse Kcnn4 protein serves as a valuable research tool across multiple experimental approaches:

  1. Western blotting and SDS-PAGE analyses for protein detection and characterization

  2. Development of functional assays to assess channel activity

  3. Structure-function relationship studies

  4. Interaction studies with potential binding partners or modulatory molecules

  5. Screening platforms for identifying channel activators or inhibitors

Therapeutic Target Exploration

Given its involvement in various pathological conditions, recombinant mouse Kcnn4 provides a platform for investigating potential therapeutic interventions targeting this channel. Research utilizing recombinant Kcnn4 can facilitate:

  1. High-throughput screening of compound libraries for modulators

  2. Structure-based drug design approaches

  3. Validation of target engagement in preclinical studies

  4. Exploration of isoform-specific targeting strategies

Role in Cancer Biology

Emerging research has identified significant connections between KCNN4 and cancer progression. A recent study published in Aging demonstrated that KCNN4 functions as a promoter of papillary thyroid cancer (PTC) progression . The investigation revealed that KCNN4 is upregulated in PTC and serves as both a diagnostic and prognostic biomarker associated with disease-free survival and immune infiltration patterns .

Mechanistic studies revealed that silencing KCNN4 in PTC cell lines inhibited cell proliferation, migration, and invasion capabilities . At the molecular level, KCNN4 appears to promote cancer progression through inducing epithelial-mesenchymal transition while simultaneously suppressing apoptotic pathways .

Additional Pathological Associations

Beyond its oncogenic potential, KCNN4 has been implicated in numerous other pathological conditions, as evidenced by extensive publication records:

  1. Fibrosis (>37 publications)

  2. Inflammatory processes (>34 publications)

  3. Cardiovascular diseases (>32 publications)

  4. Lung diseases (>20 publications)

  5. Hypertension (>14 publications)

  6. Atherosclerosis (>12 publications)

  7. Kidney diseases (>11 publications)

These associations highlight the potential therapeutic value of targeting Kcnn4 across multiple disease states.

Comparative Analysis: Mouse vs. Human KCNN4

Understanding the similarities and differences between mouse Kcnn4 and human KCNN4 is crucial for translational research. Table 1 provides a comparative analysis of key characteristics between these orthologs.

Table 1: Comparative Analysis of Mouse Kcnn4 and Human KCNN4 Properties

CharacteristicMouse Kcnn4Human KCNN4
Amino Acid Length425 amino acids Full length protein (partial segment 328-427aa mentioned in commercial products)
Molecular WeightSimilar to human orthologApproximately 47.7 kDa
Common SynonymsIK1, SK4, KCa3.1 IK1, IKCA1, KCA4, SK4
Chromosome LocationChromosome 7 Inferred from OMIM: 602754
Expression SystemHEK-293 cells Free Expression systems
Typical Purity>90% as determined by Bis-Tris Page and Western Blot ≥85% as determined by SDS-PAGE
Commercial AvailabilityAvailable as recombinant protein Available as recombinant protein

This comparative analysis illustrates the structural and functional conservation between species while highlighting specific differences relevant to experimental design and interpretation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Kcnn4; Intermediate conductance calcium-activated potassium channel protein 4; SK4; SKCa 4; SKCa4; IK1; KCa3.1; KCa4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-425
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEMLWFLGCKWVLYLLL VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV PLRSPHCALAGEATDAQPWPGFLGEGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSI GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW LIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLR EQVNSMVDISKMHMILCDLQLGLSSSHRALEKRIDGLAGKLDALTELLGTALQQQQLPEP SQEAT
Uniprot No.

Target Background

Function
Recombinant Mouse Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4) forms a voltage-independent potassium channel activated by intracellular calcium. This activation leads to membrane hyperpolarization, promoting calcium influx. Kcnn4 is essential for maximal calcium influx and proliferation during naive T-cell reactivation and plays a role in the later stages of EGF-induced macropinocytosis.
Gene References Into Functions
  1. KCa3.1 (likely the same protein as Kcnn4) is a critical target in oxidative stress. PMID: 28455747
  2. Diet-induced hyperhomocysteinemia enhances myoendothelial feedback, and increased Cx37 and IK1 (likely Kcnn4) expression may contribute. nNOS or iNOS did not upregulate to compensate for decreased eNOS and had minimal involvement in vasomotor function. PMID: 28857417
  3. KCa3.1 knockout mice showed significantly reduced corneal fibrosis and pro-fibrotic marker gene expression, highlighting KCa3.1's crucial role in corneal wound healing. PMID: 29554088
  4. KCa3.1 knockout mice exhibited significantly smaller infarct areas in an ischemic stroke model. PMID: 29037241
  5. KCa3.1 knockout mice demonstrated normal responses to acute and persistent pain models, but increased responses to noxious chemical stimuli (formalin and capsaicin), suggesting a complex role in nociception. PMID: 28823609
  6. SK4 (likely referring to Kcnn4) activity is crucial for cell cycle control. PMID: 28557306
  7. KCa3.1 deletion reduced astrogliosis and rescued memory loss induced by Aβ1-42 injection. PMID: 27567685
  8. Blocking KCa3.1 suppresses plaque instability in advanced atherosclerosis by inhibiting M1 macrophage polarization. PMID: 28062499
  9. Enhanced KCa3.1 activity may compensate for decreased nitric oxide signaling during vascular aging. PMID: 27363720
  10. KCa3.1 plays a novel role in reactive astrocyte modulation and mobilization in response to mechanical stress, representing a potential therapeutic target for brain injuries. PMID: 27163196
  11. α1D Ca and SK4 channels are coupled in the atria; α1D deletion decreases SK4 mRNA and BNP secretion, indicating a novel role for α1D in atrial endocrine function. PMID: 27884747
  12. KCa3.1 blockade protects against cisplatin-induced acute kidney injury by attenuating apoptosis through intrinsic apoptotic and endoplasmic reticulum stress-related mediators. PMID: 26438401
  13. KCa3.1 activation contributes to dysfunctional tubular autophagy in diabetic nephropathy through PI3K/Akt/mTOR signaling. PMID: 27029904
  14. IK1 channels do not mediate the slow afterhyperpolarization in pyramidal neurons. PMID: 26765773
  15. KCa3.1 is a potential marker of M/MPhi in the protumor state and a therapeutic target to restore antitumor activity in glioma-associated microglia/macrophages. PMID: 27054329
  16. KCa3.1 channels are key actors in neutrophil migration; inhibition does not affect other cellular functions. PMID: 26138196
  17. Modulation of PKA and PI3KC2β activity to control KCa3.1 channel expression may attenuate ascending thoracic aortic aneurysms in Fabry disease. PMID: 26820527
  18. KCa3.1 channel inhibition may prevent ascending thoracic aortic aneurysm development in Fabry disease. PMID: 26592662
  19. KCa3.1 inhibition by EETs, 20-HETE, and omega-3 depends on electron double bonds and hydrophobicity. PMID: 25372486
  20. NDPKB/SK4 signaling is required for neointima formation in injured carotid arteries. PMID: 26088577
  21. KCa3.1 blockade strongly reduced the growth of xenografted NSCLC cells. PMID: 25704182
  22. P2Y2/4 receptor activation elicits blood pressure responses via distinct mechanisms involving KCa3.1 and Cx37. PMID: 25545736
  23. CCL20 overexpression in human proximal tubular cells is inhibited by KCa3.1 blockade under diabetic conditions via NF-κB pathway inhibition. PMID: 24733189
  24. KCa3.1 plays a modulatory role in adult neuroblast migration, potentially influencing brain repair responses using neuronal precursor cells. PMID: 23585521
  25. KCa3.1 role in auricular lymph node CD4+ T-lymphocyte function in the delayed-type hypersensitivity model. PMID: 23594188
  26. Pulmonary hypertension in wild-type and KCa2.3/KCa3.1-deficient mice. PMID: 24858807
  27. KCa3.1 blockade attenuates diabetic renal interstitial fibrogenesis by inhibiting fibroblast activation. PMID: 24166472
  28. Targeted KCa3.1 inhibition reduces reactive gliosis in cultured astrocytes. PMID: 24606313
  29. Increased KCa3.1 activity (induced by KCa3.1α and NDPK-B upregulation) may mediate enhanced proliferative responses in MLN CD4+ T lymphocytes, contributing to IBD pathogenesis. PMID: 24674776
  30. Globotriaosylceramide accelerates endothelial KCa3.1 endocytosis and lysosomal degradation via a clathrin-dependent process, leading to endothelial dysfunction in Fabry disease. PMID: 24158513
  31. IK1 and SK3 channels positively influence endothelial Ca2+ dynamics in agonist-stimulated mesenteric arteries. PMID: 24177326
  32. KCa3.1 channel blocker prevented airway remodeling in allergic asthma. PMID: 23492185
  33. KCa3.1 channel inhibition reduces cell motility in glioblastoma-derived cancer stem cells. PMID: 23110108
  34. Genetic KCa3.1 deficiency causes locomotor hyperactivity and altered monoamine levels in brain regions. PMID: 23077667
  35. KCa3.1 channels are involved in obliterative airway disease (OAD) pathogenesis; KCa3.1 blockade may reduce OAD development. PMID: 23325003
  36. Modafinil inhibits KCa3.1 channels and vascular smooth muscle contraction via cAMP-dependent phosphorylation. PMID: 22414869
  37. Ovalbumin sensitization upregulates KCa3.1 expression in lung dendritic cells, impacting their migration to lymphatic chemokines. PMID: 21493782
  38. KCa3.1 plays a central role in gastric acid secretion. PMID: 21691077
  39. The KCa3.1 N-terminal domain is critical for channel trafficking to the plasma membrane. PMID: 21345794
  40. Globotriaosylceramide evokes KCa3.1 channel dysfunction in vascular endothelial cells, contributing to Fabry disease vasculopathy. PMID: 20971723
  41. The SK4 component of the Kslow current triggers oscillations in mice lacking KATP channels. PMID: 21099262
  42. Kcnn4 is crucial for cardiac and cardiac pacemaker cell differentiation in embryonic stem cells. PMID: 20956206
  43. KCa3.1 activity and the Gardos effect counteract hemolysis of injured erythrocytes, reducing hemoglobin release. PMID: 20857305
  44. Nucleoside diphosphate kinase B knockout mice have impaired KCa3.1 activation, resulting in defective T cell activation. PMID: 20884616
  45. KCa3.1 inhibition protected mice from severe colitis in inflammatory bowel disease models. PMID: 20080610
  46. Selective blockade of T-lymphocyte KCa3.1 and Kv1.3 channels may prevent kidney allograft rejection. PMID: 19715983
  47. SK1, -2, -3, and IK1 (likely Kcnn4) are expressed in islet cells and influence glucose-induced calcium responses, regulating insulin secretion. PMID: 12882916
  48. IK channels in red blood cells, T lymphocytes, and parotid acinar cells are encoded by the Kcnn4 gene. PMID: 15347667
  49. Cardiac Ang II overproduction leads to a long QT syndrome via IK1-dependent action potential duration prolongation through channel subunit expression modulation. PMID: 17070838
  50. Submandibular acinar cell function depends on KCNN4 channel activity. PMID: 17379640
Database Links

KEGG: mmu:16534

STRING: 10090.ENSMUSP00000133065

UniGene: Mm.9911

Protein Families
Potassium channel KCNN family, KCa3.1/KCNN4 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of KCNN4 protein?

KCNN4 is a member of the intermediate conductance calcium-activated potassium channel family. Structurally, it contains six alpha-helical hydrophobic transmembrane domains (S1-S6) with an inner hydrophobic sequence between S5 and S6 that forms the pore region responsible for ion selectivity. The functional KCNN4 channel exists as a homotetramer composed of these peptide chains .

The C-terminus of KCNN4 is linked to calmodulin, which serves as a Ca²⁺ sensor that detects intracellular calcium concentration changes and regulates channel function . This calmodulin binding is constitutive, meaning calmodulin is permanently associated with the channel . Recent full-length structural models have revealed that the intracellular domain contains restrained diffusion spots that control potassium ion movement through the channel .

How is KCNN4 activated and what are its electrophysiological properties?

KCNN4 is a non-voltage-dependent channel that is highly sensitive to changes in cytoplasmic calcium concentration. The channel is activated when intracellular Ca²⁺ binds to the calmodulin permanently attached to the channel . This activation results in membrane hyperpolarization, which subsequently promotes calcium influx through activated TRPV channels .

The channel exhibits intermediate conductance properties, distinguishing it from small (SK) and large (BK) conductance calcium-activated potassium channels. In molecular dynamics simulations, the V282 residue has been identified as a critical component controlling potassium flux, closing the pore region when the calmodulin N-lobes are not bound to calcium . The channel can accommodate both fully and partially hydrated K⁺ ions, depending on the opening level .

What physiological roles does KCNN4 play in normal cellular function?

KCNN4 channels play multiple crucial physiological roles:

  • Cell volume regulation: KCNN4 participates in erythrocyte volume control. When activated, K⁺ outflow is accompanied by water loss, causing erythrocyte dehydration and shrinkage .

  • Calcium signaling: The channel controls Ca²⁺ influx and regulates calcium signal transduction processes .

  • Vascular function: KCNN4 contributes to endothelial smooth muscle cell hyperpolarization, mediating voltage-gated Ca²⁺ channel closure and causing smooth muscle relaxation .

  • Cell proliferation: The channel regulates proliferation of T-lymphocytes and smooth muscle cells .

  • Secretory processes: KCNN4 is involved in secretion from epithelial cells of the digestive tract, lungs, and secretory glands .

  • Cell cycle regulation: Studies have demonstrated KCNN4's importance in regulating the cell cycle .

What are effective methods for studying KCNN4 expression and function in experimental settings?

To investigate KCNN4 expression and function, researchers can employ several methodological approaches:

  • Gene expression analysis: Quantitative PCR and microarray analysis can be used to measure KCNN4 expression levels. Multiple studies have used these techniques to identify KCNN4 overexpression in cancer tissues compared to normal tissues, as demonstrated in PDAC studies using GEO datasets (GSE16515, GSE28735, GSE15471) .

  • Genetic manipulation: Construction of short hairpin RNAs (shRNA) and siRNA targeting KCNN4 allows specific knockdown of expression. For example, researchers have used shKCNN4-1 targeting the sequence 5ʹ-CCGGGCCTGGATGTTCTACAAACATCTCGAGATGTTTGTAGAACATCCAGGCTTTTTG-3ʹ and shKCNN4-2 targeting 5′-CCGGCGCTCTCAATCAAGTCCGCTTCTCGAGAAGCGGACTTGATTGAGAGCGTTTTTG-3ʹ .

  • Functional assays: Cell proliferation (CCK8 assay, trypan blue staining, colony formation), migration, and apoptosis (TUNEL staining, flow cytometry) assays can assess the functional impacts of KCNN4 modulation .

  • Promoter analysis: Luciferase reporter assays can investigate transcriptional regulation of KCNN4. Researchers have identified activator protein-1 (AP-1) binding sequences in the KCNN4 promoter region that regulate its expression .

  • Molecular dynamics simulations: All-atom molecular dynamic simulations of full-length models can reveal structural dynamics in different conformational states .

What animal models are most appropriate for studying KCNN4 in disease contexts?

Animal models that have proven valuable for KCNN4 research include:

  • Xenograft mouse models: Human cancer cell lines with KCNN4 knockdown or overexpression can be implanted into immunodeficient mice to study tumor growth and progression in vivo .

  • Genetic knockout/knockin models: KCNN4-deficient mice have been used to study the role of this channel in disease. One notable example is a cystic fibrosis (CF) mouse model with KCNN4 silencing, which demonstrated that Kcnn4 is an intestinal CF modifier gene. This model showed significantly reduced lethality compared to standard CF mice .

  • Double mutant models: To study interactions between KCNN4 and other disease-relevant pathways, double mutant animals can be created. For example, CF animals lacking mast cells (C-kit W-sh/W-sh) have been developed to investigate the relationship between KCNN4 and mast cell function in intestinal disease .

How can researchers accurately measure KCNN4 channel activity in experimental settings?

Several methodological approaches can be used to measure KCNN4 channel activity:

  • Electrophysiological techniques: Patch-clamp recording remains the gold standard for directly measuring ion channel activity, allowing researchers to observe changes in membrane potential and ionic currents in response to calcium or pharmacological modulators.

  • Calcium imaging: Since KCNN4 activation is dependent on intracellular calcium, techniques that measure calcium flux can indirectly assess channel activity.

  • Membrane potential assays: Fluorescent voltage-sensitive dyes can detect hyperpolarization events associated with KCNN4 activation.

  • Pharmacological approaches: Channel-specific inhibitors (like TRAM-34) or activators can be used in combination with functional assays to assess channel contribution to cellular processes.

  • Molecular dynamics simulations: Computer modeling can reveal ion permeation pathways and gating mechanisms. Recent studies have shown that K⁺ flux through KCNN4 is controlled by the V282 residue closing the pore region when calmodulin N-lobes are not bound to calcium .

What is the evidence for KCNN4's role in cancer progression?

KCNN4 has been implicated in multiple cancers, with strong evidence supporting its role in promoting malignancy:

Pancreatic Ductal Adenocarcinoma (PDAC):

  • KCNN4 is significantly overexpressed in PDAC compared to normal tissues, as confirmed by multiple independent datasets .

  • Functional studies demonstrate that KCNN4 knockdown suppresses proliferation, migration, and increases apoptosis in PDAC cells .

  • KCNN4 promotes PDAC progression through the Ca²⁺/MET/AKT signaling axis .

  • In vivo studies confirm that KCNN4 knockdown inhibits tumor growth, while overexpression enhances tumor formation .

Papillary Thyroid Carcinoma (PTC):

  • High KCNN4 expression is associated with increased risk of lymph node metastasis (LNM) in PTC patients .

  • Multivariate logistic regression analysis shows that high KCNN4 expression is an independent risk factor for LNM with an odds ratio of 2.914 (95% CI: 1.925-4.411, p<0.001) .

FactorsUnivariate analysisMultivariate analysis
OR95% CIp-valueOR95% CIp-value
KCNN4 expression (high vs. low)3.6652.483-5.409<0.001*2.9141.925-4.411<0.001*
Age (>60 vs. <60)0.6530.416-1.0240.063---
Gender (female vs. male)0.6400.422-0.9720.036*0.7700.482-1.2290.274
Disease stage (III,IV vs. I,II)3.5242.336-5.316<0.001*2.7081.656-4.428<0.001*
T stage (III,IV vs. I,II)2.6881.820-3.970<0.001*1.7031.054-2.7530.03*

Table 1: Univariate and multivariate logistic regression analyses of risk factors for lymph node metastasis in papillary thyroid carcinoma patients .

How does KCNN4 function as a modifier gene in non-cancer pathologies?

Beyond cancer, KCNN4 has been identified as an important modifier gene in other pathological conditions:

Cystic Fibrosis (CF):

  • KCNN4 has been identified as an intestinal CF modifier gene. The Kcnn4 gene is present in a locus linked with occurrence of intestinal CF-disease in both mice and humans .

  • Silencing of Kcnn4 in CF-mouse models almost completely abolishes lethality, suggesting a protective effect .

  • Interestingly, this protective effect is not through improved intestinal secretory functions but rather through correcting increased circulating TNF-α levels and reducing intestinal mast cell increases .

  • Research indicates that Kcnn4 partially acts through a STAT6-dependent mechanism in modifying intestinal CF disease .

Vascular Diseases:

  • KCNN4 is closely associated with various vascular diseases including pulmonary hypertension, systemic hypertension, diabetes, and atherosclerosis .

  • These associations likely relate to KCNN4's role in regulating smooth muscle cell function and vascular tone .

What prognostic value does KCNN4 expression have in clinical settings?

KCNN4 expression has demonstrated significant prognostic value in several clinical contexts:

  • Cancer prognosis: Overexpression of KCNN4 correlates with poorer prognosis in patients with PDAC . This supports its potential use as a prognostic biomarker.

  • Metastasis prediction: In PTC, high KCNN4 expression is strongly associated with lymph node metastasis, with multivariate analysis confirming it as an independent risk factor (OR=2.914, 95% CI: 1.925-4.411, p<0.001) . This suggests KCNN4 could serve as a predictive marker for metastatic potential.

  • Disease staging: KCNN4 expression may complement traditional staging parameters in multiple cancer types. In PTC, KCNN4 expression remains significant even when accounting for other established risk factors like disease stage and T stage .

  • Therapy selection: As KCNN4 interacts with specific signaling pathways (like Ca²⁺/MET/AKT), its expression profile might help identify patients who would benefit from targeted therapies directed at these pathways .

How does KCNN4 interact with the Ca²⁺/MET/AKT signaling axis in cancer progression?

KCNN4 promotes cancer progression through complex interactions with the Ca²⁺/MET/AKT signaling axis:

  • Pathway identification: Pathway enrichment analysis based on TCGA database and RNA sequencing of KCNN4-knockdown cells reveals that the AKT pathway has a close correlation with KCNN4 .

  • MET as a mediator: MET, a classical upstream mediator of the AKT pathway, is closely related to KCNN4 function. KCNN4 may regulate MET expression or activation, subsequently affecting AKT signaling .

  • Calcium dependence: As a calcium-activated channel, KCNN4 responds to changes in intracellular calcium. This activation can trigger calcium-dependent signaling cascades that ultimately influence the AKT pathway .

  • Functional consequences: Through this signaling axis, KCNN4 promotes proliferation, migration, and resistance to apoptosis in cancer cells. KCNN4 knockdown reduces phosphorylation of AKT and its downstream effectors, confirming this relationship .

  • Therapeutic implications: Understanding this signaling axis suggests that targeting KCNN4 along with components of the MET/AKT pathway might provide synergistic therapeutic benefits in cancers where this axis is active .

What role does phosphatidylinositol-4,5-bisphosphate (PIP2) play in modulating KCNN4 channel function?

Phosphatidylinositol-4,5-bisphosphate (PIP2) has emerged as an important modulator of KCNN4 channel function:

  • Direct activation: Molecular dynamics simulations reveal that PIP2, when present in a putative binding site of KCNN4, clearly facilitates the opening of the V282 restriction that controls K⁺ flux through the channel .

  • Conformational changes: PIP2 appears to induce conformational changes in the channel structure that promote the open state, enhancing potassium conductance .

  • Physiological context: As a membrane phospholipid that is regulated by various signaling pathways, PIP2 may provide a mechanism for integrating KCNN4 activity with broader cellular signaling networks .

  • Experimental evidence: The direct activatory role of PIP2 in channel opening has been confirmed through molecular dynamics studies of the complete intracellular region of KCNN4 .

How is KCNN4 expression transcriptionally regulated?

The transcriptional regulation of KCNN4 involves several key mechanisms:

  • AP-1 mediated regulation: Analysis of the KCNN4 promoter region (2000 bp upstream of the transcription start site) reveals three putative activator protein-1 (AP-1) binding sequences (TGAGACA, TGAGTGA, and TGACTCT). Luciferase reporter assays confirm that AP-1 activates KCNN4 transcription. This is significant because AP-1 is overexpressed in human PDAC .

  • Inhibition studies: Treatment with SP600125, an AP-1 inhibitor, reduces KCNN4 expression, further confirming the role of AP-1 in regulating KCNN4 transcription .

  • Growth factor regulation: The expression of KCNN4 is modulated by various growth factors, including fibroblast growth factor (FGF) and transforming growth factor β (TGF-β). In smooth muscle cells, these growth factors regulate calcium signaling and KCNN4 activity through protein kinase phosphatase signaling pathways .

  • Signaling pathway influence: KCNN4 expression is also regulated by Ras/MEK/ERK and JAK/STAT signaling pathways, providing additional layers of transcriptional control .

What evidence supports KCNN4 as a therapeutic target in cancer treatment?

Multiple lines of evidence support KCNN4 as a promising therapeutic target:

How might KCNN4 modulation be leveraged in treating non-cancer diseases?

KCNN4 modulation shows therapeutic potential in several non-cancer conditions:

  • Cystic Fibrosis: Silencing of Kcnn4 in CF-mouse models almost completely abolishes lethality, suggesting that KCNN4 inhibition might have therapeutic benefits in CF patients . This effect appears to be mediated through regulation of inflammatory signaling rather than direct effects on secretory function.

  • Vascular diseases: Given KCNN4's role in regulating vascular smooth muscle function and its association with pulmonary hypertension, systemic hypertension, diabetes, and atherosclerosis , modulating its activity might provide therapeutic benefits in these conditions.

  • Inflammatory disorders: KCNN4 plays important roles in inflammatory disease , suggesting that targeting this channel might help manage inflammatory conditions. This is supported by findings that KCNN4 modulation affects TNF-α levels and mast cell activity in mouse models .

  • Secretory disorders: Since KCNN4 participates in secretion from epithelial cells of the digestive tract, lungs, and secretory glands , its modulation might be useful in treating conditions involving aberrant secretory processes.

What are the current challenges in developing KCNN4-targeting therapeutics?

Despite its promise as a therapeutic target, several challenges exist in developing KCNN4-targeting drugs:

  • Selectivity issues: Developing compounds that specifically target KCNN4 without affecting other potassium channels remains challenging. Cross-reactivity could lead to unwanted side effects.

  • Tissue-specific expression: KCNN4 is expressed in multiple tissues and cell types, potentially limiting the ability to target specific disease sites without systemic effects.

  • Complex regulation: KCNN4 function is regulated by multiple factors including calcium, calmodulin, PIP2 , and various signaling pathways. This complexity makes it difficult to predict the full consequences of therapeutic modulation.

  • Incomplete structural understanding: While significant progress has been made in elucidating KCNN4 structure , some aspects of its function, particularly regarding the complete intracellular domain, remain incompletely understood.

  • Context-dependent effects: KCNN4 may have different, sometimes opposing, effects depending on the disease context. For example, while inhibiting KCNN4 might be beneficial in certain cancers, its activation might be needed in other conditions like some vascular diseases.

  • Delivery methods: For genetic approaches targeting KCNN4, effective delivery systems for gene silencing or editing technologies would need to be developed for clinical application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.