Recombinant Mouse Inward rectifier potassium channel 13 (Kcnj13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnj13; Inward rectifier potassium channel 13; Inward rectifier K(+ channel Kir7.1; Potassium channel, inwardly rectifying subfamily J member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj13
Target Protein Sequence
MDSSNCKVNAPLLSQRHRRMVTKDGHSTLQMDGAQRGLVYLRDAWGILMDMRWRWMMLVF SASFVVHWLVFAVLWYAVAEMNGDLEIDHDVPPENHTICVKHITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH KDGKPNLIFQVANTRPSPLTNVRVSAVLYQERENGELYQTSVDFHLDGISSEECPFFIFP LTYYHTISPSSPLATLLQHETPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHRFA ALMTRGSKGEYQVKMENFDKTVPEHPTPVVSKSPHRTDLDIHINGQSIDNFQIAETGLTE
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the voltage range of channel opening to more positive potentials. Inward rectification primarily results from intracellular magnesium block of outward current. KCNJ13 exhibits low single-channel conductance, low sensitivity to external barium and cesium block, and its inward rectification is independent of intracellular magnesium.

Gene References Into Functions
  1. Kcnj13 mutations result in shortened tracheas and impaired smooth muscle cell alignment and polarity. Kcnj13 maintains ion homeostasis in tracheal smooth muscle cells, which is crucial for actin polymerization, at least partly via AKT activation. PMID: 30022023
  2. KCNJ13 expression is necessary for retinal pigment epithelium (RPE) cell maintenance of photoreceptor survival. PMID: 25666713
  3. Kir7.1 (KCNJ13) regulates the transition from quiescence to contraction in the pregnant uterus. PMID: 25056913
  4. The coupling of MC4R to Kir7.1 may explain unique aspects of melanocortin signaling's control of energy homeostasis, including the gene dosage effect of MC4R and the sustained effects of AgRP on food intake. PMID: 25600267
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ13 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Kcnj13-encoded Kir7.1 channels in mice?

Kir7.1 channels encoded by the Kcnj13 gene are inwardly rectifying potassium channels primarily expressed in epithelial tissues where they share membrane localization with the Na+/K+-pump . Their primary function appears to be maintaining the resting membrane potential and facilitating potassium transport across epithelial barriers. In tissues such as the choroid plexus, Kir7.1 channels generate characteristically large rubidium (Rb+) currents, suggesting their role in ionic regulation in confined spaces . In the retinal pigment epithelium, Kir7.1 likely contributes to the ionic regulation at the RPE/photoreceptor interface, potentially in relation to lactate transport .

What is the tissue distribution pattern of Kir7.1 in mice?

Kir7.1 channels show a specific tissue distribution pattern in mice:

Tissue/OrganExpression LocationMembrane Localization
Choroid plexusAbundant expressionApical membrane
EyePresentNot specified in data
Trachea and lungRespiratory tract epitheliumBasolateral membrane
IntestineExclusively in ileumNot specified in data
KidneyInner medulla collecting ductsNot specified in data
Nasal cavity/nasopharynxRespiratory epithelial cellsBasolateral membrane

Notably, unlike previous reports in rats and guinea pigs, Kir7.1 expression in mice is restricted to the inner medulla of the kidney and absent from the cortex or outer medulla .

Why are Kcnj13 knockout mice models difficult to study?

Kcnj13 knockout mice experience perinatal mortality, which has thwarted extensive research using these models. The mortality is attributed to incomplete palate sealing, a malformation known to lead to perinatal death . Additionally, Kir7.1 null mice exhibit moderate retardation in lung development, suggesting the channel's importance in respiratory system development . These limitations have prompted researchers to develop alternative approaches, such as the Kir7.1-HA knock-in mouse that expresses the channel tagged with a hemagglutinin epitope to facilitate localization studies without disrupting channel function .

How can researchers effectively generate and validate Kcnj13 knock-in models?

Generating effective Kcnj13 knock-in models requires strategic planning:

  • Strategic epitope placement: When creating tagged versions of Kir7.1, introduce tags (such as HA) into extracellular loops after the first transmembrane domain. This approach has been demonstrated not to affect function in other Kir family members .

  • CRISPR/Cas9 methodology:

    • Design guide RNAs targeting exon 2 of the Kcnj13 gene

    • Create a single-stranded oligodeoxynucleotide (ssODN) containing the tag sequence, restriction site for screening (e.g., EcoRV), and homologous arms

    • Use homology-directed repair (HDR) for precise insertion

  • Validation protocol:

    • Molecular validation: PCR followed by restriction enzyme digestion to confirm insertion

    • Functional validation: Electrophysiological recordings to verify that tagged channels retain normal conductance properties, including characteristic Rb+ currents

    • Immunolocalization studies: Confirm proper membrane targeting using anti-tag antibodies, with wild-type tissues as negative controls

The Kir7.1-HA knock-in approach overcomes the limitations of knockout models while providing a superior tool for localization studies due to the availability of highly specific anti-HA antibodies.

What electrophysiological properties distinguish Kir7.1 channels from other inward rectifier potassium channels?

Kir7.1 channels exhibit distinctive electrophysiological characteristics that differentiate them from other Kir channel subtypes:

  • Unusually large rubidium currents: Kir7.1 channels demonstrate characteristically large Rb+ currents compared to K+ currents, which serves as a functional signature .

  • Rectification properties: While they show inward rectification, the degree and voltage-dependence of rectification differs from other Kir subtypes like Kir2.1 and Kir2.2, which exhibit strong inward rectification .

  • External K+ sensitivity: Unlike Kir2.x channels whose currents (IKir) are strongly dependent on external [K+] (96 and 24 mM), Kir7.1 shows distinct external K+ sensitivity profiles .

  • Single-channel conductance: Kir7.1 demonstrates lower single-channel conductance compared to other Kir family members.

When designing experimental protocols to characterize recombinant Kir7.1 channels, researchers should include both K+ and Rb+ conductance measurements to confirm channel identity and function.

How does the subcellular localization of Kir7.1 vary across different epithelial tissues, and what experimental approaches best detect this distribution?

The subcellular localization of Kir7.1 shows tissue-specific patterns that reflect specialized functions:

TissueMembrane LocalizationDetection MethodFunctional Implication
Choroid plexusApical membraneImmunofluorescence with anti-HA antibodiesRegulation of CSF composition
Respiratory tractBasolateral membraneImmunofluorescenceMaintenance of airway fluid layer
Nasal cavityBasolateral membraneImmunofluorescenceEpithelial ion transport
Kidney (inner medulla)Collecting ductsIsolated tubule immunolocalizationMedullary K+ transport

Optimal experimental approaches:

  • For fixed tissues:

    • HA-tagged knock-in models provide superior specificity compared to commercial anti-Kir7.1 antibodies

    • Confocal microscopy with z-stacking to resolve apical versus basolateral localization

    • Co-staining with Na+/K+-ATPase to confirm membrane domain specificity

  • For live-cell imaging:

    • Fluorescently tagged versions can be used for dynamic localization studies

    • CRISPR/Cas9-mediated knock-in reporter lines to monitor expression in real-time

The differential membrane targeting of Kir7.1 suggests tissue-specific roles in transepithelial ion transport that may depend on interactions with other transporters, particularly the Na+/K+-pump.

What are the most effective strategies for functional characterization of recombinant Kcnj13 in heterologous expression systems?

For robust functional characterization of recombinant Kcnj13, implement this methodological framework:

  • Expression system selection:

    • Mammalian cell lines (HEK293, CHO) generally provide better trafficking of Kir7.1 than Xenopus oocytes

    • Consider co-expression with interacting proteins identified in native tissues

  • Electrophysiological protocols:

    • Whole-cell patch clamp: Use step protocols from -140 mV to +40 mV with holding potential of -80 mV

    • External solutions: Test multiple [K+] concentrations (12, 24, 48, and 96 mM) to characterize external K+ dependence

    • Include Rb+ substitution experiments to identify characteristic large Rb+ currents

    • Pharmacology: Test channel sensitivity to Ba2+ and Cs+ block

  • Data analysis approach:

    • Calculate current-voltage relationships

    • Determine reversal potentials at different [K+]

    • Assess rectification properties by comparing currents at equivalent driving forces

  • Validation controls:

    • Include wild-type Kir7.1 alongside any mutated or tagged constructs

    • Use species orthologs (e.g., mouse vs. human Kcnj13) to validate functional conservation

This comprehensive approach ensures accurate characterization of channel properties while allowing for comparative analysis across experimental conditions.

How can researchers effectively study Kcnj13 regulation in native tissues given the perinatal lethality of knockout models?

To overcome the challenges posed by perinatal lethality in Kcnj13 knockout mice, researchers can employ these alternative strategies:

  • Conditional knockout approaches:

    • Generate floxed Kcnj13 alleles for tissue-specific deletion using appropriate Cre lines

    • Employ inducible systems (tetracycline-responsive or tamoxifen-inducible) for temporal control

  • Ex vivo tissue preparations:

    • Harvest tissues from embryonic or neonatal knockout mice before lethality

    • Maintain in organ culture systems to study short-term physiological consequences

  • Knockdown strategies in adult tissues:

    • Use adeno-associated virus (AAV) delivery of shRNA targeting Kcnj13

    • Apply CRISPR interference (CRISPRi) for transient suppression

  • Transgenic rescue approaches:

    • Generate composite models with tissue-specific rescue of Kcnj13 expression

    • Utilize the Kir7.1-HA knock-in model for both localization and functional studies

  • Isolated tissue experiments:

    • For electrophysiological studies in tissues like choroid plexus, use acute pharmacological inhibition

    • Combine with optical measurements to detect membrane potential changes in the transverse tubular system membranes

These approaches allow researchers to circumvent complete knockout lethality while maintaining the ability to study tissue-specific functions of Kcnj13.

How do mutations in Kcnj13 contribute to retinal pathologies, and what mouse models best recapitulate these conditions?

Mutations in human KCNJ13 are associated with severe retinal pathologies including snowflake vitreoretinal degeneration (SVD) and Leber congenital amaurosis . These conditions can be studied using specialized mouse models:

  • Disease mechanisms:

    • Loss-of-function mutations typically cause trafficking defects that prevent channel localization to the plasma membrane

    • Functional defects alter K+ homeostasis at the RPE/photoreceptor interface

    • Disruption of ionic regulation affects lactate transport essential for photoreceptor metabolism

  • Recommended mouse models:

    • Mosaic expression models: Mice with mosaic expression of Kcnj13 in the retinal pigment epithelium allow study of focal retinal degeneration

    • Knock-in models of human mutations: Introduction of specific human pathogenic variants

    • Conditional knockout in RPE: Tissue-specific deletion to avoid perinatal lethality

    • shRNA knockdown models: Local suppression of Kcnj13 expression in the eye

  • Experimental readouts:

    • Electroretinography (ERG) to assess retinal function

    • Optical coherence tomography (OCT) for structural assessment

    • Lactate measurements in subretinal space

    • Immunohistochemical analysis of retinal layer organization

Studies using a mouse model with mosaic expression of Kcnj13 in the RPE suggest that the channel plays a crucial role in the ionic regulation of the confined space between RPE and photoreceptors, potentially related to lactate transport .

What is the relationship between Kcnj13 expression levels and phenotypic outcomes in development and disease models?

Research indicates a quantitative relationship between Kcnj13 expression levels and phenotypic outcomes:

  • Developmental contexts:

    • Complete loss of expression results in palate development defects and perinatal lethality

    • Reduced expression correlates with moderate lung development retardation

    • In fish models, quantitative changes in Kcnj13 expression can alter pigmentation patterns without complete disruption of development

  • Expression-phenotype correlations:

    • High expression: Normal epithelial function and development

    • Moderate reduction: Subtle functional changes without structural defects

    • Severe reduction: Structural developmental abnormalities

    • Complete absence: Lethal developmental defects

  • Regulatory mechanisms:

    • Cis-regulatory changes rather than protein-coding variations appear to underlie expression differences between species

    • Studies in fish show that the D. rerio Kcnj13 allele expresses at higher levels than the D. aesculapii allele, correlating with pattern differences

  • Methodological considerations:

    • Researchers should quantify expression levels when interpreting phenotypes

    • CRISPR/Cas9-mediated knock-in reporter lines can detect expression in specific cell populations

    • Single-cell transcriptomics may reveal cell-type specific expression patterns not apparent in bulk tissue analysis

This quantitative relationship suggests that precise regulation of Kcnj13 expression is crucial for normal development and function, with different tissues showing varying sensitivity to expression changes.

What are the optimal approaches for distinguishing Kir7.1 currents from other K+ currents in native tissues?

Isolating Kir7.1 currents in native tissues presents technical challenges due to the presence of multiple K+ channel types. Implement these strategies for confident identification:

  • Biophysical discrimination:

    • Exploit the characteristic inward rectification properties

    • Utilize voltage protocols that emphasize Kir7.1's distinct current-voltage relationship

    • Test with Rb+ substitution to identify the characteristically large Rb+ currents specific to Kir7.1

  • Pharmacological approach:

    • Apply VU590 or VU591 (selective Kir7.1 inhibitors) to isolate Kir7.1-specific component

    • Use Ba2+ concentration-response profiling (Kir7.1 shows distinct sensitivity compared to other Kir channels)

    • Block other K+ channels with specific inhibitors (e.g., 4-AP for Kv channels)

  • Genetic verification:

    • Compare currents in tissues from wild-type and Kir7.1-HA knock-in mice

    • Use shRNA knockdown to confirm channel identity

    • Perform patch-clamp recordings in tissues with fluorescently labeled Kir7.1 channels

  • Mathematical modeling:

    • Implement computational modeling approaches that account for K+ depletion from restricted spaces like the transverse tubular system

    • The model should incorporate Kir permeability values (~5.5 × 10−6 cm s−1) and distribution patterns to predict current signatures

These combined approaches provide necessary verification to confidently identify and study Kir7.1 currents in complex native tissues.

How can researchers effectively isolate and purify recombinant Kcnj13 protein for structural and biochemical studies?

For successful isolation and purification of recombinant Kcnj13 protein:

  • Expression system optimization:

    • Mammalian cells (HEK293F) for authentic post-translational modifications

    • Insect cells (Sf9) for higher yield

    • Consider fusion tags that don't interfere with channel assembly (N-terminal tags are preferable)

  • Solubilization strategy:

    • Use mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)

    • Include cholesterol hemisuccinate to maintain tetrameric structure

    • Keep potassium concentrations physiological throughout purification

  • Purification protocol:

    • Two-step affinity chromatography using His-tag and secondary tag (e.g., FLAG)

    • Size-exclusion chromatography to confirm tetrameric assembly

    • Consider lipid nanodisc reconstitution for functional studies

  • Quality control metrics:

    • Western blot analysis to confirm purity and molecular weight

    • Negative stain electron microscopy to verify quaternary structure

    • Functional validation in proteoliposomes using K+ flux assays

  • Structural stabilization:

    • Screen lipid compositions to identify stabilizing conditions

    • Consider co-expression with antibody fragments or nanobodies

    • Use thermostability assays to optimize buffer conditions

For the Kir7.1-HA variant, the HA tag provides an additional purification handle through anti-HA affinity chromatography, improving yield and purity while enabling detection with widely available antibodies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.