Recombinant Mouse Inward rectifier potassium channel 2 (Kcnj2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type for prioritized development.
Synonyms
Kcnj2; Irk1; Inward rectifier potassium channel 2; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-428
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Kcnj2
Target Protein Sequence
GSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDTSKVSK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPR PLRRESEI
Uniprot No.

Target Background

Function
Inward rectifier potassium channel Kir2.1 likely plays a role in establishing action potential waveforms and excitability in neuronal and muscle tissues. These channels preferentially allow potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification primarily results from intracellular magnesium block. Extracellular barium and cesium can block the channel.
Gene References Into Functions
  1. Cellular electrophysiology assays in mouse Kir2.1 and human Kir2.2 showed that a Leu residue enhances phosphatidylinositol diphosphate (PIP2) responses via increased binding affinity and faster activation kinetics, while deactivation kinetics decrease upon PIP2 inhibition. PMID: 26520451
  2. Endothelial cell Kir2 channels appear to augment vasodilatory signals stemming from Ca(2+)-dependent activation of IK and SK channels. PMID: 26840527
  3. Studies suggest that the cell adhesion molecule Cdo signaling is crucial for Kir2.1 activity in myogenic differentiation. PMID: 27380411
  4. Microglial Kir2.1 channels may be therapeutic targets for inhibiting excessive reactive oxygen species production in brain pathologies. PMID: 27598576
  5. Three weak interaction pairs precisely regulate the G-loop gate of the Kir2.1 channel. PMID: 27699887
  6. Kir2.1 channels contribute to hyperpolarization and the lack of tone in urinary bladder arterioles. PMID: 28148533
  7. This is the first functional evidence showing a significant role of the dystrophin-associated protein complex in regulating Kir2.x channels. PMID: 27560040
  8. Intracellular Mg(2+) and SPM may synergistically block the pore, potentially by preventing the outward exit of higher-affinity blocking SPM by lower-affinity Mg(2+). PMID: 26869275
  9. Proton entry through a Zn(2+)-sensitive conductance transiently blocks the KIR2.1 current, suggesting a role for the K(+) current in amplifying sensory responses. PMID: 26627720
  10. Mouse neutrophils in bone marrow and liver express functional Kir2.1 channels. PMID: 25472961
  11. The A184R mutation in Kir2.1 abolishes inward rectification features of spermine block and promotes channel pore closure. PMID: 24633623
  12. A functional Kir2.1-like channel is expressed in lactating mouse mammary secretory cells. PMID: 24259419
  13. LPS downregulates Kir2.1 mRNA levels, with a lesser effect observed with IL-4/IL-13. PMID: 24249731
  14. A pentamidine analogue specifically blocks the cardiac KIR2.1 channel, prolonging action potential duration. PMID: 23625347
  15. Total Kcnj2 (Kir2.1 gene) mRNA is reduced in Huntington disease skeletal muscle. PMID: 23671115
  16. miR-26 regulates KCNJ2 expression and may be involved in atrial fibrillation. PMID: 23543060
  17. Ventricular-like and atrial-like cells exhibit stronger SCN5a, SCN1b, and Kir2.1 expression compared to pacemaker-like cardiomyocytes. PMID: 22348965
  18. Kir2.1 is necessary for I(K1) in type II utricle hair cells. PMID: 22496522
  19. An inwardly rectifying K+ channel is required for patterning. PMID: 22949619
  20. I(KCa), I(Cl.vol), and I(Kir) currents are heterogeneously present in 3T3-L1 preadipocytes; I(KCa) and I(Cl.vol) regulate cell proliferation. PMID: 21732368
  21. Blocking kinetics depend on driving force, leading to driving force-dependent inward rectification when the potassium equilibrium potential changes. PMID: 20962011
  22. HL-1 cardiac myocytes express a current characteristic of cardiac inward rectifier K(+) channels and express K(ir)2.1 mRNA. PMID: 20568224
  23. Early Kir2.1 expression in hair cells inhibits spontaneous activity needed for spiral ganglion neuron survival and neurite growth. PMID: 20045730
  24. The Ras signaling pathway modulates the inward rectifier potassium channel IRK1. PMID: 11809752
  25. AMPA receptors modulate inward rectifier K+ channels in mouse hippocampal astrocytes. PMID: 11906215
  26. K+ influx from neurons into glial cells is mainly mediated by strongly rectifying Kir channels (Kir2.1), expressed at glia-neuron interaction sites. PMID: 12203395
  27. Single and double mutations in the Kir2.1 M1-M2 segment define conductance states and highlight M1-M2's role in pore conformation adjustments. PMID: 12369836
  28. Negative charges at E224, E299, and D172 coordinate surface charge reduction and open channel components of polyamine block. PMID: 12740427
  29. IK1 upregulation's adverse effects on cardiac electrical activity are consistent with its significant role in cardiac excitability. PMID: 15271672
  30. Kv1.3 and Kir2.1 expression is impaired in the brain during cancer cachexia. PMID: 15304346
  31. A short N-terminal sequence in the Kir2.1 linker is crucial for high-affinity TPN inhibition; sequence variability underlies TPN affinity variations among eukaryotic Kir channels. PMID: 15311931
  32. E224 and E299 are allosteric modulators of a fast gate in Kir2.1 channels, located at or below the bundle crossing. PMID: 15459242
  33. E153 acts as a surface charge, influencing Kir2.1 conductance properties. PMID: 15824191
  34. Alterations in these proteins and their modifications might predispose striatal projection neurons to dysfunction and degeneration in Huntington's disease. PMID: 15880743
  35. The PSD95 PDZ domain-Kir2.1 tail interaction involves regions beyond the known binding motif, potentially important for interactions with other PDZ-containing proteins. PMID: 17437338
  36. Mouse heart IK1 upregulation is proarrhythmic. PMID: 17546530
  37. Functional Kir2.1 ion channel currents are present in mouse bone marrow mesenchymal stem cells. PMID: 17699636
  38. Restricted dynamics and preferential Kir2.1 binding to PDZ2 allow SAP97 to function as a scaffold, enabling other proteins to bind to other PDZ domains to form channelosomes. PMID: 18004877
  39. PIP(2) interaction with a single Kir2.1 subunit suffices for channel activation and full conductance; interactions with additional subunits exhibit positive cooperativity. PMID: 18276733
  40. Astrocytic Kir2.1 channels may buffer extracellular K(+) accumulation from neuronal hyperexcitability under pathophysiological conditions. PMID: 18319624
  41. This study describes the transcription profiles of the four HCN genes from embryonic stage E9.5 dpc to postnatal day 120 in the mouse. PMID: 19421833
Database Links

KEGG: mmu:16518

STRING: 10090.ENSMUSP00000037192

UniGene: Mm.4951

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.
Tissue Specificity
Prominently expressed in the central nervous system. Also found in other excitable tissues such as heart and skeletal muscle.

Q&A

What is the basic structure and functional role of Kcnj2 channels?

Kcnj2 encodes the Kir2.1 protein, a member of the inward rectifier potassium channel family. Structurally, Kir2.1 channels are tetramers consisting of both transmembrane and cytoplasmic domains. Each monomer contains two transmembrane helices (TM1 and TM2) connected by a pore loop, with large cytoplasmic N-terminal and C-terminal domains.

Key structural features include:

  • Transmembrane regions at positions 82-106 and 157-178

  • Selectivity filter that determines K+ specificity

  • G-loop region in the cytoplasmic domain that forms a girdle around the central pore

  • Slide helix and tether helix regions critical for gating

Functionally, Kir2.1 channels:

  • Maintain the resting membrane potential in excitable cells

  • Contribute to phase-3 repolarization of cardiac action potentials

  • Regulate excitability in cardiac myocytes, neurons, and skeletal muscle

  • Allow K+ to flow more easily into rather than out of cells (inward rectification)

Recent structural analyses using computational molecular modeling have provided insights into how mutations affect channel conformation and stability through altered interaction profiles .

How does inward rectification occur in Kcnj2 channels?

Inward rectification is a defining characteristic of Kir2.1 channels, whereby they preferentially conduct K+ in the inward direction with minimal outward conductance. This phenomenon occurs through a voltage-dependent block by intracellular factors.

The mechanism involves:

  • Blockage by intracellular Mg²⁺ and polyamines (particularly spermine) at depolarized potentials

  • Removal of this block at hyperpolarized potentials

Critical molecular determinants include:

  • A negatively charged residue (Asp172) in the TM2 helix, known as the "D/N site," which is essential for strong rectification

  • Serine at position 165 (S165) in TM2, crucial for Mg²⁺ but not polyamine block

  • Negatively charged glutamate residues (E224 and E229) in the cytoplasmic domain that interact with polyamines

The degree of rectification varies among Kir subfamilies. Kir2.x channels are "strong rectifiers," meaning they show pronounced inward rectification compared to other subtypes .

Experimental evidence shows that mutation of the D/N site (changing Asn to Asp) in weakly rectifying channels can convert them to strong rectifiers by increasing affinity for Mg²⁺ .

How do Kcnj2 channels behave during different phases of cardiac action potentials?

During cardiac action potentials, Kir2.1 channels play distinct roles depending on the membrane potential:

Phase 4 (Resting Membrane Potential):

  • Kir2.1 channels remain open, allowing K⁺ efflux that maintains negative resting potential

  • Despite being "inward rectifiers," they permit sufficient outward current at rest to stabilize membrane potential

Phase 0-2 (Depolarization and Plateau):

  • During depolarization, polyamines and Mg²⁺ block Kir2.1 channels

  • This blockade prevents K⁺ efflux that would otherwise oppose depolarization

Phase 3 (Repolarization):

  • As repolarization begins, the block is gradually relieved

  • Kir2.1 channels work alongside delayed rectifier K⁺ channels to restore resting potential

A common confusion arises regarding their role at rest: while they predominantly allow inward current under voltage-clamp conditions, they conduct outward current at rest in physiological settings to maintain negative resting potential .

What are the optimal methods for expressing recombinant Kcnj2 in cellular models?

Successful expression of functional recombinant Kcnj2 requires careful consideration of expression systems and protocols:

Recommended Expression Systems:

Expression SystemAdvantagesConsiderations
HEK293 cellsHigh transfection efficiency; Minimal endogenous K⁺ channelsRequires 24-48 hours post-transfection for optimal expression
tsA201 cellsEfficient for transient expression; Good for electrophysiologySimilar to HEK293 but with enhanced protein expression
Xenopus oocytesRobust expression; Suitable for two-electrode voltage-clampRequires 2-3 days post-injection; Manual defolliculation needed

Optimized Protocol for HEK293 Expression:

  • Clone full-length Kcnj2 cDNA into a mammalian expression vector (e.g., pCMV-Script)

  • Transfect using FUGENE-6 or similar reagent (2μg DNA per 35mm dish)

  • Add fluorescent tag (e.g., GFP) for visualization if needed

  • Culture for 24-48 hours post-transfection before experiments

  • Maintain cells at 37°C with 5% CO₂ in DMEM supplemented with 10% FBS

For mutation studies, use PCR-mediated site-directed mutagenesis followed by full sequencing to confirm mutation and exclude polymerase errors .

What electrophysiological approaches are most effective for studying Kcnj2 channel function?

Electrophysiological characterization of Kcnj2 channels requires specific approaches to capture their unique properties:

Patch Clamp Techniques:

TechniqueBest ApplicationsKey Parameters
Whole-cell configurationMacroscopic current measurements; Rectification analysisSampling rate ≥10 kHz; Series resistance <5 MΩ
Two-electrode voltage clampXenopus oocyte recordingsUsing Warner OC-725B amplifier or equivalent
Cell-attached patchSingle channel analysisHigh resistance seals (>10 GΩ)

Recommended Voltage Protocols:

  • Rectification Protocol: Voltage steps from -120 mV to +40 mV to assess inward rectification

  • Spermine Sensitivity: Compare currents with/without intracellular spermine

  • Mg²⁺ Sensitivity: Compare currents with varying intracellular Mg²⁺ concentrations

Critical Parameters:

  • Internal solution: K⁺-based with defined free Mg²⁺ (typically 1 mM)

  • External solution: High K⁺ (140 mM) to maximize inward current amplitude

  • Temperature control: Recordings at both room temperature and physiological temperature (37°C)

  • pH: Maintain at 7.2-7.4, as Kir2 channels show pH sensitivity

Recent studies demonstrate that wild-type Kir2.1 expressing cells exhibit substantial currents (-4.5 ± 1.9 nA at -120 mV), while diseased mutants show dramatically reduced currents (e.g., Y145C mutant: -0.17 ± 0.07 nA) .

How can post-translational modifications of Kcnj2 be identified and characterized?

Comprehensive characterization of Kcnj2 post-translational modifications (PTMs) requires integrated proteomic approaches:

Recommended Workflow:

  • Protein Isolation:

    • Immunoprecipitation with anti-Kir2.1 antibodies (e.g., N112B/14 clone)

    • Membrane fractionation to enrich channel proteins

  • Integrated Proteomic Analysis:

    • Top-down proteomics: Analysis of intact protein to preserve modification stoichiometry

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Phosphorylation-specific enrichment using TiO₂ or IMAC

  • Modification-Specific Analysis:

    • Phosphorylation: Phosphatase treatment controls and phospho-specific antibodies

    • Ubiquitination: Detection with anti-ubiquitin antibodies

    • Glycosylation: PNGase F treatment and lectin affinity

Recent research has identified six phosphorylation sites in Kir2.1, five of which were novel, using an integrated top-down and bottom-up proteomic approach. This methodology successfully mapped phosphorylation sites that may regulate channel function in response to β-adrenergic tone .

For functional validation of identified PTMs, site-directed mutagenesis to create phosphomimetic (e.g., S→D) or phospho-null (e.g., S→A) mutants, followed by electrophysiological characterization, is highly recommended.

What are the functional consequences of KCNJ2 mutations associated with Andersen-Tawil Syndrome?

Andersen-Tawil Syndrome (ATS) is primarily caused by loss-of-function mutations in KCNJ2. These mutations affect channel function through several mechanisms:

Dominant-Negative Effects:
Most ATS mutations (including R67W, Y145C, and R218L) act through dominant-negative mechanisms, where mutant subunits interfere with wild-type subunit function in heteromeric channels.

Functional Impact by Mutation Category:

Mutation TypeElectrophysiological EffectsMolecular Mechanism
Trafficking-deficient (e.g., Δ314-315)Complete loss of surface expressionER retention; disrupted forward trafficking
Permeation-defective (e.g., G300D)Reduced K⁺ conductanceAltered G-loop structure affecting pore function
Gating-defective (e.g., R67Q)Impaired response to regulatory signalsDisrupted PIP₂ binding; altered activation
PIP₂-binding defectiveReduced channel activityWeakened interaction with essential lipid regulator

Experimental Evidence:
When expressed alone, most ATS mutants (e.g., R67Q) produce minimal or no inward rectifier current. When co-expressed with wild-type Kir2.1, they significantly reduce current density compared to wild-type alone. For example, R67Q-Kir2.1/WT-Kir2.1 failed to increase peak outward current density after PKA stimulation, while WT-Kir2.1 increased by 46% .

Recent molecular dynamics simulations and computational modeling have provided atomic-level insights into how specific mutations disrupt channel function, revealing mutation-specific structural perturbations that could guide precision therapeutic approaches .

What animal models are most effective for studying Kcnj2 function and disease phenotypes?

Several animal models have been developed to study Kcnj2 function and related diseases:

Zebrafish Models:

  • Advantages: Rapid development, transparent embryos allowing easy visualization

  • Application: Expression of mutant kcnj2-12 transcripts in zebrafish results in phenotypes similar to human ATS

  • Findings: Zebrafish expressing mutant Kcnj2 exhibit defects in muscle development affecting movement, decreased jaw size, altered pupil-pupil distance, and scoliosis, corresponding to human ATS phenotypes

Mouse Models:

  • Homozygous Kcnj2 knockout mice present with cleft palate and die within hours after birth

  • Heterozygous models better replicate human disease features

  • Recent studies show mutation-specific phenotypes, with sex-specific cardiac manifestations in some models

Recommended Model Selection:

Research QuestionRecommended ModelJustification
Developmental effectsZebrafishRapid development; easy visualization of morphological changes
Cardiac phenotypesMouse heterozygous modelsCloser cardiac physiology to humans
Cellular mechanismsCell line expression systemsAllows precise control of mutation expression
In vivo drug screeningZebrafishHigh throughput capability for compound screening

For investigating extracardiac manifestations, zebrafish models have proven particularly valuable, as they develop phenotypes that correlate well with human dysmorphic features in ATS .

How do KCNJ2 mutations lead to different clinical phenotypes?

KCNJ2 mutations are associated with several distinct clinical phenotypes, with mechanistic differences explaining this diversity:

Phenotype-Genotype Correlations:

Clinical PhenotypeMutation TypeFunctional Consequences
Andersen-Tawil Syndrome (ATS)Loss-of-function (e.g., R67W, Y145C)Dominant-negative effect; >50% reduction in current
Short QT Syndrome 3Gain-of-functionEnhanced channel activity; increased K⁺ efflux
CPVT-like phenotypeLoss-of-function (e.g., R67Q, P186Q)Altered calcium sensitivity; PKA response defects
Familial Atrial FibrillationGain-of-functionShortened atrial action potential

Molecular Basis for Phenotypic Variability:

  • Tissue-specific effects: Differential expression of compensatory channels

  • Sex-specific modifiers: Female predominance in CPVT-like presentations (all reported KCNJ2-mutated CPVT patients are female)

  • Mutation location: Mutations in different functional domains affect specific channel properties

  • Modifier genes: Background genetic factors influence phenotypic expression

Recent research has identified unique electrophysiological signatures that help distinguish KCNJ2-related CPVT from RYR2-related CPVT:

  • KCNJ2-CPVT: Ventricular arrhythmias appear early, stop at peak exercise, then reappear after exercise

  • RYR2-CPVT: Arrhythmias appear early, increase to maximum at peak, then stop at rest

Understanding these phenotype-genotype correlations is critical for accurate diagnosis and appropriate therapeutic selection.

How can computational modeling enhance our understanding of Kcnj2 channel gating?

Computational modeling provides powerful insights into Kcnj2 channel dynamics that are difficult to obtain experimentally:

State-of-the-Art Modeling Approaches:

TechniqueApplicationsKey Insights
Homology ModelingStructure predictionFull-length models of open/closed conformations
Molecular Dynamics (MD)Conformational dynamicsGating transitions; protein-lipid interactions
Principal Component Analysis (PCA)Collective motionsIdentifying dominant motion patterns
Normal Mode AnalysisLow-frequency motionsChannel gating mechanisms
Free Energy LandscapeStability of conformationsEnergy barriers between functional states

Recent Methodological Advances:
A comprehensive computational approach combining multiple techniques has recently been applied to study ATS mutations (R67Q, R218L, G300D):

  • Full-length Kir2.1 models were developed for both open and closed conformations

  • Site-directed mutagenesis identified altered interaction profiles

  • MD simulations assessed mutation impacts on channel conformation

  • PCA and normal mode analysis revealed mutation-specific structural perturbations

For researchers implementing these approaches, it's recommended to:

  • Use the latest structural templates (e.g., Kir2.2 crystal structure, PDB ID: 6M84)

  • Perform extensive validation including ion conduction analysis with HOLE software

  • Include regulatory molecules like PIP₂ in simulations

  • Extend simulation times to capture complete conformational changes

What is known about the interactome of Kir2.1 channels and how can it be studied?

The Kir2.1 interactome comprises proteins that physically associate with the channel and regulate its function, trafficking, and degradation:

Key Interactome Components:

  • Trafficking regulators (e.g., PKP4)

  • Signaling molecules (insulin-like growth factor receptor pathway)

  • Lysosomal degradation components

  • Other ion channels forming macromolecular complexes

Advanced Methods for Interactome Analysis:

TechniqueApplicationAdvantages
BioID proximity labelingIn vivo interaction mappingIdentifies transient interactions; works in native environment
Co-immunoprecipitationDirect binding partnersVerifies physical interactions
Yeast two-hybridProtein-protein interaction screeningHigh-throughput screening capability
Proximity Ligation Assay (PLA)In situ interaction verificationVisualizes interactions in cellular context
Mass spectrometryInteractome compositionUnbiased identification of complex components

Research Findings:
Recent studies using the proximity-labeling approach BioID have generated a comprehensive map of the Kir2.1 interactome, identifying 218 high-confidence interactions. This approach successfully distinguished interaction profiles between wild-type Kir2.1 and ATS mutants (e.g., Kir2.1Δ314-315), providing insights into molecular mechanisms underlying disease .

Functional validation through patch-clamp analysis confirmed that identified interactors (e.g., PKP4) can modulate Kir2.1-controlled inward rectifier potassium currents, validating the physiological relevance of the interactome data .

How do post-translational modifications regulate Kcnj2 function?

Post-translational modifications (PTMs) provide dynamic regulation of Kcnj2 channel properties:

Major Regulatory PTMs:

ModificationSitesFunctional ImpactRegulatory Context
PhosphorylationS425 and 5 novel sitesAlters current density; Response to β-adrenergic stimulationSympathetic activation
PIP₂ bindingBasic residues in C-terminusEssential for channel activationMembrane lipid composition
UbiquitinationMultiple lysine residuesTargets channel for degradationProtein turnover regulation
GlycosylationN-terminal sitesAffects trafficking efficiencyQuality control

Regulatory Mechanisms:
PKA-mediated phosphorylation has been shown to increase wild-type Kir2.1 current by 46%, while mutant channels (R67Q/WT-Kir2.1) failed to respond appropriately, providing a mechanism for disease pathophysiology .

The strength of channel-PIP₂ interaction varies among Kir2.x isoforms, with Kir2.1 binding more strongly than Kir2.3. Mutations that weaken this interaction (e.g., R312Q) increase sensitivity to inhibition by phospholipase C, protein kinase C, and protons .

Research Approach:
For investigating PTM regulation, a combined approach is recommended:

  • Proteomic identification of modification sites (mass spectrometry)

  • Site-directed mutagenesis to create non-modifiable or mimetic mutants

  • Functional characterization using patch-clamp electrophysiology

  • Biochemical assays to determine modification dynamics under different conditions

This integrated approach has successfully identified novel phosphorylation sites and demonstrated their importance in β-adrenergic regulation of cardiac excitability .

Why might recombinant Kcnj2 show poor expression or function in heterologous systems?

Several factors can compromise successful expression of functional Kcnj2 channels:

Common Issues and Solutions:

ProblemPossible CausesRecommended Solutions
Low protein expressionSuboptimal codon usage; Toxicity to cellsUse codon-optimized constructs; Use inducible expression systems
Lack of surface expressionTrafficking defects; ER retentionCo-express with chaperones; Lower incubation temperature (30°C)
Poor current densityInsufficient auxiliary factorsSupplement with PIP₂; Ensure appropriate intracellular Mg²⁺
Atypical rectificationContaminating currentsUse specific blockers for endogenous channels; Use Kir2.1-null cell lines
Rapid rundownPIP₂ depletionAdd PIP₂ to internal solution; Inhibit lipid phosphatases

Expert Recommendations:

  • Always sequence verify the entire construct before expression experiments

  • Include a fluorescent tag (e.g., GFP) to monitor expression and localization

  • Use confocal microscopy to confirm proper membrane localization

  • Include positive controls (wild-type channels) in every experiment

  • For mutant studies, compare homomeric and heteromeric (with WT) expression

Molecular biology approaches like codon optimization and the inclusion of protein stabilization domains can significantly improve expression levels in challenging systems .

How can the physiological relevance of in vitro findings be validated?

Translating in vitro findings to physiologically relevant contexts requires several validation approaches:

Multi-level Validation Strategy:

LevelApproachKey Considerations
Cellular contextPrimary cell isolation and cultureUse cardiac myocytes, skeletal muscle cells from relevant species
Tissue levelOrganotypic culture; Tissue slicesPreserve native cellular environment and channel interactions
In vivo modelsTransgenic animals; Viral transductionEnsure tissue-specific expression; Control expression levels
Human relevancePatient-derived iPSCs; Genotype-phenotype correlationConnect molecular findings to clinical manifestations

Implementation Recommendations:

  • Confirm expression patterns using RT-PCR and western blot in native tissues

  • Validate physiological function with sharp electrode recordings in tissue slices

  • Use gene-edited animal models that precisely replicate human mutations

  • For disease models, validate both cardiac and extracardiac phenotypes

Recent zebrafish models have successfully reproduced human ATS phenotypes including muscle defects, movement impairment, decreased jaw size, and scoliosis, providing strong validation of the role of KCNJ2 mutations in these extracardiac manifestations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.