Recombinant Mouse Inward rectifier potassium channel 4 (Kcnj4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Kcnj4; Irk3; Inward rectifier potassium channel 4; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnj4
Target Protein Sequence
MHGHNRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWWIAFFHGDLEASPSVPAVGGPGGNGGESPNAPKPCIMHVNGF LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL PAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGS HLDLERMQAATLPLDNISYRRESRI
Uniprot No.

Target Background

Function

Inward rectifier potassium channels (IRKs) are characterized by their preferential inward potassium current flow. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification is primarily due to intracellular magnesium block. These channels are susceptible to block by extracellular barium and cesium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ4 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Note=TAX1BP3 binding promotes dissociation of KCNJ4 from LIN7 family members and KCNJ4 internalization.
Tissue Specificity
Highly expressed in the forebrain, moderately in skeletal muscle. Im olfactory bulb, specifically expressed at the postsynaptic membrane of dendritic spines of granule cells.

Q&A

What is the molecular structure and basic properties of Kcnj4?

Kcnj4 (also known as Kir2.3, IRK3, HIRK2, HRK1) is encoded by the KCNJ4 gene and belongs to the inwardly rectifying K+ (Kir) channels family, specifically the Kir2 subfamily. Like other Kir channels, each Kcnj4 monomer contains two transmembrane helix domains (M1 and M2), an ion-selective P-loop between M1 and M2, and cytoplasmic N- and C-terminal domains. The functional channel forms as a tetramer, with four subunits arranged to create a central pore .

The basic properties of Kcnj4 include:

  • Strong inward rectification and constitutive activity

  • Activation by phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2)

  • Insensitivity to membrane voltage due to lack of S4 voltage sensor

  • Multi-ion pore characteristics with conductance dependent on extracellular K+ concentration

Basic Information of KCNJ4
Protein NameInward rectifier potassium channel 4
Gene NameKCNJ4
AliasesKir2.3, IRK3, HIRK2, HRK1
Transmembrane Domains2
Length (aa)445
Primary DistributionHeart and brain, especially cardiac myocytes and forebrain region
Subcellular LocalizationPrimarily at postsynaptic membrane of excitatory synapses

Where is Kcnj4 predominantly expressed in mouse tissues?

Kcnj4 (Kir2.3) is predominantly expressed in both heart and brain tissues of mice. In the heart, it is particularly abundant in cardiac myocytes, while in the brain, it shows strong expression in the forebrain region. At the subcellular level, Kcnj4 is mainly localized at the postsynaptic membrane of excitatory synapses .

Recent studies have also identified Kcnj4 expression in interstitial cells of Cajal (ICC) from murine colonic muscles. Transcriptional analysis has confirmed the presence of Kcnj4 (Kir2.3) alongside other inwardly rectifying K+ channels including Kcnj2 (Kir2.1), Kcnj14 (Kir2.4), Kcnj5 (Kir3.4), Kcnj8 (Kir6.1), and Kcnj11 (Kir6.2) in these cells .

What are the primary physiological functions of Kcnj4 channels?

Kcnj4 channels play important roles in the regulation of:

  • Resting membrane potential - As constitutively active channels, they contribute to establishing highly negative resting potentials in various cell types

  • Cellular excitability - By modulating membrane potential, they influence the threshold for action potential generation

  • Potassium homeostasis - They facilitate K+ movement across cell membranes in the nervous system and various peripheral tissues

  • Cardiac electrophysiology - Kcnj4 participates in cardiac classical inward rectifier potassium currents (IK1) in neonatal rat cardiomyocytes, contributing to the long-lasting action potential plateau in cardiac myocytes

In colonic ICC, Kir2 channels (including Kcnj4) are active under resting conditions, as evidenced by depolarization observed when Kir2 antagonists are applied to freshly dispersed ICC and colonic smooth muscles .

What are the optimal expression systems for recombinant mouse Kcnj4?

For functional expression of recombinant mouse Kcnj4, researchers commonly use:

  • Xenopus oocytes - Advantages include robust expression, ease of microinjection, and well-established electrophysiological recording techniques. Recommended for initial characterization and mutational studies.

  • Mammalian cell lines (HEK293, CHO cells) - Provide a more physiologically relevant environment and are suitable for:

    • Detailed biophysical characterization

    • Protein-protein interaction studies

    • Trafficking experiments

    • High-throughput screening platforms

  • Cardiomyocyte cell lines - Particularly useful when studying Kcnj4 in cardiac contexts, as these cells express native cardiac proteins that may interact with Kcnj4.

When designing expression constructs, consider:

  • Including epitope tags (HA, Myc) for detection and immunoprecipitation

  • Using fluorescent protein fusions for trafficking studies

  • Employing inducible expression systems for controlled expression levels

Note that expression efficiency and channel properties can vary between systems, so validation across multiple platforms is recommended for comprehensive characterization .

What electrophysiological protocols are most effective for characterizing Kcnj4 currents?

For robust characterization of recombinant mouse Kcnj4 currents, the following patch-clamp protocols are recommended:

  • Voltage-clamp protocol for inward rectification assessment:

    • Hold at -60 mV

    • Apply voltage steps from -140 mV to +40 mV in 10-20 mV increments

    • Plot current-voltage relationship to visualize rectification properties

    • Compare rectification index (RI): ratio of outward current at +20 mV to inward current at -100 mV relative to reversal potential

  • External K+ concentration testing:

    • Record currents in varying extracellular K+ concentrations (1-150 mM)

    • Analyze the relationship between conductance and [K+]o (typically follows square root dependence)

    • This confirms multi-ion pore characteristics typical of Kir channels

  • Pharmacological profiling:

    • Apply Ba2+ (10 μM-1 mM) for dose-dependent blockade

    • Test sensitivity to external Cs+ (0.1-10 mM)

    • Evaluate responses to modulators such as PtdIns(4,5)P2

For whole-cell recording, use intracellular solutions containing:

  • 140 mM K+ (as KCl or K-gluconate)

  • 1-2 mM MgCl2

  • 1 mM EGTA

  • 10 mM HEPES (pH 7.2)

And extracellular solutions with:

  • 5-150 mM K+ (vary for specific protocols)

  • 150 mM Na+ (adjust based on K+ concentration)

  • 1 mM MgCl2

  • 1.8 mM CaCl2

  • 10 mM HEPES (pH 7.4)

How can I effectively differentiate between Kcnj4 and other Kir2 family members in native tissues?

Distinguishing between Kcnj4 (Kir2.3) and other Kir2 family members in native tissues requires a multifaceted approach:

  • Electrophysiological properties:

    • Kcnj4 shows intermediate rectification strength (stronger than Kir2.3 but weaker than Kir2.1)

    • Unique sensitivity to extracellular pH (more sensitive than Kir2.1 and Kir2.2)

    • Distinctive single-channel conductance (~13 pS compared to ~28 pS for Kir2.1)

  • Pharmacological profiling:

    • Differential sensitivity to Ba2+ (Kcnj4 shows IC50 of ~10 μM, between Kir2.1 and Kir2.4)

    • Unique responses to flecainide and propafenone compared to other Kir2 channels

  • Molecular approaches:

    • Subtype-specific antibodies for immunohistochemistry or Western blotting

    • RT-qPCR with highly specific primers (sequences in table below)

    • Subtype-specific siRNA knockdown followed by functional assessment

PrimerSequence (5' to 3')Product Size (bp)
Kcnj2 (Kir2.1) ForwardCACCAGCTTGGCTACGTCATTG254
Kcnj2 (Kir2.1) ReverseCGGCGCGCTCTTCATGTATC254
Kcnj4 (Kir2.3) ForwardACCTACTTTGTGGAGATCCTGG227
Kcnj4 (Kir2.3) ReverseGCGAGTCATCGTTCACAACTG227
Kcnj14 (Kir2.4) ForwardCCTACATTGACCTGAAGATCG208
Kcnj14 (Kir2.4) ReverseCAGAATGCCCAGGTACACAAT208
  • Expression pattern analysis:

    • Kcnj4 shows enrichment in forebrain and cardiac tissues

    • Compare with Kir2.1 (widespread), Kir2.2 (brain, heart, skeletal muscle), and Kir2.4 (brain, retina)

For definitive identification in complex tissues, it is recommended to use a combination of these approaches rather than relying on a single method .

How do heteromeric assemblies of Kcnj4 with other Kir2.x subunits affect channel properties?

Kcnj4 (Kir2.3) can form functional heteromeric channels with other Kir2.x subunits, resulting in biophysical and regulatory properties distinct from homomeric channels:

  • Kir2.1/Kir2.3 heteromers:

    • Show intermediate rectification properties

    • Display modified single-channel conductance (~20 pS)

    • Exhibit unique PtdIns(4,5)P2 sensitivity

    • Demonstrate altered pH sensitivity compared to homomeric channels

    • Show intermediate Ba2+ and polyamine sensitivity

  • Kir2.2/Kir2.3 heteromers:

    • Present altered kinetics of current activation

    • Display modified trafficking properties

    • Exhibit different pharmacological profiles

The stoichiometry of these heteromeric assemblies significantly impacts their properties. Biophysical analyses have revealed that the dominant-negative effects of mutations can vary depending on the subunit composition.

In cardiac tissues, the heteromeric assembly of Kir2.1/Kir2.3 channels contributes to the regional differences in IK1 current density and kinetics across different parts of the heart, potentially influencing cardiac excitability and arrhythmogenesis. Similar heteromeric assemblies have been identified in brain tissues, where they contribute to regional differences in neuronal excitability .

What are the latest techniques for studying Kcnj4 protein-protein interactions and regulatory mechanisms?

Recent advances in studying Kcnj4 protein-protein interactions and regulatory mechanisms include:

  • Proximity-labeling approaches:

    • BioID method - fusion of a biotin ligase to Kcnj4 allows identification of proximal proteins

    • APEX2-based proximity labeling for subcellular localization of interacting partners

    • These approaches have identified novel Kir channel interactors, including cytoskeletal proteins and trafficking regulators

  • Advanced proteomic analysis:

    • Integrated top-down and bottom-up proteomic approaches

    • Quantitative phosphoproteomics to identify regulatory phosphorylation sites

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

  • Live-cell imaging techniques:

    • FRET/BRET-based approaches to monitor dynamic protein interactions

    • Single-molecule tracking to follow channel trafficking and membrane dynamics

    • Super-resolution microscopy (STORM, PALM) for nanoscale organization

  • Functional interaction assays:

    • Electrophysiological analysis of co-expressed proteins

    • Lipid reconstitution systems with purified proteins

    • Cell-free expression systems for direct interaction studies

These approaches have revealed that Kir2.3 interacts with multiple regulatory proteins including PKA, PKC, filamin, and PSD-95, and its activity is modulated by phosphorylation at specific residues. Recent studies using BioID approaches have uncovered interactions with the insulin-like growth factor receptor signaling pathway, expanding our understanding of Kcnj4 regulation .

How do post-translational modifications affect Kcnj4 function and trafficking?

Post-translational modifications (PTMs) significantly impact Kcnj4 function, trafficking, and stability:

  • Phosphorylation:

    • PKA-mediated phosphorylation at serine residues affects channel activity

    • PKC phosphorylation sites modulate PtdIns(4,5)P2 sensitivity

    • Phosphorylation status affects heteromeric assembly with other Kir2.x subunits

    • Tyrosine phosphorylation impacts surface expression and stability

  • Ubiquitination:

    • Regulates channel turnover and degradation

    • Lysine residues in the C-terminus serve as ubiquitination sites

    • Affects channel quality control in the endoplasmic reticulum

  • SUMOylation:

    • Modulates channel activity independently of trafficking

    • Affects interaction with regulatory proteins

    • Can alter channel sensitivity to modulators

  • Glycosylation:

    • N-linked glycosylation affects proper folding and trafficking

    • Influences channel stability at the plasma membrane

    • May protect against proteolytic degradation

For studying these modifications, mass spectrometry-based approaches are particularly valuable. Recent proteomic analyses integrating both top-down (intact protein) and bottom-up (after enzymatic digestion) approaches have identified specific phosphorylation sites that impact channel function and assembly. These methods have revealed the importance of serine phosphorylation in regulating channel activity and response to PKA stimulation .

What role does Kcnj4 play in pathophysiological conditions?

Kcnj4 has been implicated in several pathophysiological conditions, though its role is often studied in the context of heteromeric channels with other Kir2.x subunits:

  • Cardiac arrhythmias:

    • Alterations in Kcnj4 expression or function can modify IK1 currents, affecting cardiac excitability

    • Contributes to the electrophysiological substrate for arrhythmogenesis

    • Dysregulation of heteromeric Kir2.1/Kir2.3 channels has been observed in atrial fibrillation

  • Neurological disorders:

    • Implicated in epilepsy models due to its role in neuronal excitability

    • Changes in Kcnj4 expression affect synaptic function at excitatory synapses

    • May contribute to homeostatic plasticity mechanisms

  • Gastrointestinal motility disorders:

    • Expression in ICC of colonic muscles suggests a role in regulating gastrointestinal motility

    • Kir2 antagonists cause depolarization of ICC and colonic smooth muscles

    • Altered expression or function may contribute to motility disorders

  • Andersen-Tawil syndrome:

    • While primarily associated with Kir2.1 mutations, the formation of heteromeric channels with Kcnj4 suggests potential involvement

    • Interactions between mutant Kir2.1 and wild-type Kcnj4 may contribute to phenotypic variability

Experimental approaches to study these pathophysiological roles include:

  • Tissue-specific knockout or knockdown models

  • Expression analysis in disease tissues

  • Functional characterization using electrophysiology

  • Computational modeling to predict effects on cellular excitability

What are the critical quality control steps for producing functional recombinant mouse Kcnj4?

To ensure high-quality recombinant mouse Kcnj4 protein production, implement these critical quality control steps:

  • Sequence verification:

    • Confirm the complete coding sequence matches reference sequence

    • Verify absence of mutations, especially in critical regions (pore, PtdIns(4,5)P2 binding sites)

    • Check for correct reading frame with any fusion tags

  • Expression validation:

    • Western blot analysis to confirm protein of expected size

    • Immunofluorescence to verify subcellular localization

    • Flow cytometry for quantitative assessment of expression levels

  • Functional testing:

    • Patch-clamp electrophysiology to verify characteristic inward rectification

    • Barium sensitivity assays (IC50 ~10 μM)

    • PtdIns(4,5)P2 dependence testing

  • Protein folding and stability assessment:

    • Limited proteolysis to evaluate folding quality

    • Thermal shift assays to assess protein stability

    • Size exclusion chromatography to verify tetrameric assembly

  • Control experiments:

    • Include positive controls (well-characterized Kir channels)

    • Use negative controls (non-functional mutants, empty vectors)

    • Test in multiple expression systems for consistent results

For rigorous quality control, analyze multiple protein preparation batches and establish acceptance criteria for purity (≥95%), yield, and functional parameters before proceeding with experimental studies .

How can I optimize Kcnj4 expression and purification for structural studies?

Optimizing recombinant mouse Kcnj4 expression and purification for structural studies requires specialized approaches:

  • Expression system selection:

    • Insect cells (Sf9, High Five) often yield higher protein quantities

    • Mammalian expression (HEK293-GnTI-) provides native-like post-translational modifications

    • Yeast systems can be scaled for large-volume production

  • Construct optimization:

    • Remove flexible regions (consider N-terminal truncations)

    • Include affinity tags (His8, Twin-Strep) for purification

    • Consider fusion partners (e.g., MBP, GFP) to enhance stability

    • Include TEV or PreScission protease sites for tag removal

  • Solubilization optimization:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Test lipid/detergent mixtures for enhanced stability

    • Consider nanodiscs or amphipols for cryo-EM studies

    • Evaluate styrene maleic acid copolymers (SMALPs) for native lipid co-extraction

  • Purification strategy:

    • Multi-step approach:
      a. Affinity chromatography (IMAC, Strep-Tactin)
      b. Size exclusion chromatography
      c. Optional ion exchange for high purity

    • Include PtdIns(4,5)P2 during purification to stabilize the protein

    • Perform purification at 4°C with protease inhibitors

  • Quality assessment for structural studies:

    • Negative stain EM to verify homogeneity and particle distribution

    • Thermal stability assays (CPM, nano-DSF) to optimize buffer conditions

    • FSEC (fluorescence-detection size exclusion chromatography) for monitoring tetrameric assembly

    • Mass photometry to verify stoichiometry

For successful structure determination, aim for protein concentrations of ≥5 mg/ml with ≥95% purity and monodisperse behavior on size exclusion chromatography .

What are the best approaches for studying heteromeric channels containing Kcnj4?

Studying heteromeric channels containing Kcnj4 (Kir2.3) requires specialized approaches to control subunit composition and distinguish properties:

  • Controlled co-expression strategies:

    • Tandem constructs linking multiple subunits with flexible linkers

    • Bicistronic vectors with different expression levels

    • Inducible expression systems for titrating subunit ratios

    • Different tags on each subunit for identification and purification

  • Biochemical verification of heteromerization:

    • Co-immunoprecipitation with subunit-specific antibodies

    • FRET/BRET assays to confirm physical association

    • Blue native PAGE to analyze native complexes

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Functional characterization techniques:

    • Whole-cell patch clamp with defined biophysical protocols

    • Single-channel recordings to identify subconductance states

    • Pharmacological profiling with subunit-specific modulators

    • Dominant-negative approach with non-functional mutants of specific subunits

  • Experimental design considerations:

    • Use dominant-negative constructs to suppress homomeric channels

    • Apply mathematical models to deconvolute mixed currents

    • Employ concatemeric constructs to enforce specific stoichiometries

    • Utilize expression systems with minimal endogenous K+ channels

For conclusive identification of heteromeric channels, combine multiple approaches and include appropriate controls such as homomeric channels for comparison. By using tandem constructs with fixed stoichiometry, you can systematically investigate how the ratio of different subunits affects channel properties .

How can computational modeling enhance our understanding of Kcnj4 function?

Computational modeling offers powerful insights into Kcnj4 function across multiple scales:

  • Molecular dynamics (MD) simulations:

    • All-atom simulations reveal conformational dynamics

    • Identify ion permeation pathways and energy barriers

    • Characterize PtdIns(4,5)P2 binding sites and mechanisms

    • Predict effects of mutations on channel structure and function

  • Homology modeling and structure prediction:

    • Generate Kcnj4 structural models based on related Kir channels

    • Use AlphaFold2 or RoseTTAFold for structure prediction

    • Identify key residues for channel function and modulation

    • Model heteromeric assemblies with other Kir2.x subunits

  • Systems biology approaches:

    • Integrate Kcnj4 into cell-level electrophysiological models

    • Predict contributions to cellular excitability

    • Model tissue-level effects in cardiac or neuronal networks

    • Simulate pathophysiological conditions and therapeutic interventions

  • Mathematical modeling of channel properties:

    • Develop Markov models of channel gating

    • Simulate rectification by incorporating polyamine block

    • Model effects of pH, ATP, and other modulators

    • Predict behavior of heteromeric channels with mixed subunit composition

To implement these approaches effectively:

  • Use the latest available Kir channel structures as templates

  • Incorporate experimental data for validation and refinement

  • Employ appropriate force fields for membrane protein simulation

  • Consider lipid-protein interactions, particularly with PtdIns(4,5)P2

Recent computational studies have provided insights into how molecular perturbations in Kir channels propagate to affect cellular excitability, offering a framework to analyze mechanisms of action potential generation and regulation in various cell types .

How can I address common challenges when recording Kcnj4 currents in heterologous expression systems?

When recording Kcnj4 currents in heterologous systems, researchers frequently encounter these challenges with corresponding solutions:

  • Low expression levels:

    • Optimize codon usage for expression system

    • Use high-efficiency promoters (CMV, CAG)

    • Include Kozak sequence for efficient translation

    • Consider using expression enhancers (e.g., Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element)

    • Allow 48-72 hours post-transfection for optimal expression

  • Current rundown during recording:

    • Include PtdIns(4,5)P2 or PtdIns(4,5)P2 precursors in patch pipette

    • Add ATP (2-5 mM) to internal solution to maintain lipid kinase activity

    • Record in perforated patch configuration to preserve cytoplasmic factors

    • Minimize recording time for critical measurements

    • Use FVPP solution (fluoride, vanadate, pyrophosphate) to inhibit phosphatases

  • Contaminating endogenous currents:

    • Select expression systems with minimal endogenous K+ currents (e.g., CHO-K1)

    • Use specific inhibitors to block endogenous channels

    • Perform control recordings in untransfected cells

    • Design experiments to pharmacologically isolate Kcnj4 currents (Ba2+ sensitivity)

  • Variable rectification properties:

    • Control intracellular polyamine concentrations in patch solutions

    • Use defined concentrations of spermine (50-100 μM) and spermidine (100-200 μM)

    • Include Mg2+ (1 mM) for physiological rectification

    • Prepare fresh internal solutions to avoid polyamine oxidation

  • Trafficking issues:

    • Co-express with chaperone proteins

    • Incubate cells at lower temperature (30°C) for 24-48 hours

    • Use trafficking enhancers specific to Kir channels

    • Co-express with other Kir2.x subunits for enhanced trafficking

For reliable recordings, maintain consistent recording conditions across experiments and include positive controls (e.g., well-characterized Kir2.1 channels) for comparison .

What strategies can overcome reproducibility issues in Kcnj4 functional studies?

To enhance reproducibility in Kcnj4 functional studies, implement these systematic strategies:

  • Standardized expression protocols:

    • Document complete transfection protocols with reagent ratios and timing

    • Use stable cell lines for long-term studies

    • Quantify expression levels via western blot or fluorescent tags

    • Report passage number and growth conditions for cell lines

    • Implement quality control at each experimental stage

  • Consistent recording conditions:

    • Define standardized solutions with exact composition and pH

    • Control temperature during recordings (report and maintain consistently)

    • Use identical protocols for voltage-clamp experiments

    • Specify cell capacitance and series resistance compensation parameters

    • Document time post-transfection for recordings

  • Robust analysis pipelines:

    • Apply automated analysis algorithms to minimize subjective interpretation

    • Use blinded analysis when possible

    • Calculate and report rectification indices using consistent definitions

    • Include raw data traces in publications

    • Share analysis code via repositories

  • Comprehensive controls:

    • Include positive and negative controls in each experiment

    • Test known modulators to confirm channel identity

    • Measure background currents in untransfected cells

    • Validate antibodies with knockout/knockdown controls

    • Use multiple methods to verify key findings

  • Detailed methodology reporting:

    • Provide complete methods including plasmid sources/sequences

    • Specify exact buffer compositions with all additives

    • Report analysis methods with statistical approaches

    • Document software versions and settings

    • Consider sharing raw data in repositories

These practices have significantly improved reproducibility in recent Kir channel studies, particularly when investigating subtle differences between heteromeric channel compositions or effects of disease-causing mutations .

What emerging technologies will advance Kcnj4 research in the next five years?

Several cutting-edge technologies are poised to transform Kcnj4 research in the coming years:

  • Cryo-EM for structural biology:

    • High-resolution structures of Kcnj4 homomers and heteromers

    • Visualization of conformational changes during gating

    • Structures with bound modulators and regulatory proteins

    • Time-resolved cryo-EM for capturing dynamic states

  • Advanced genome editing techniques:

    • CRISPR-based precise knock-in models for studying mutations

    • Base-editing and prime-editing for specific modifications

    • CRISPRa/CRISPRi for endogenous expression modulation

    • Tissue-specific and inducible editing systems

  • Single-cell technologies:

    • Patch-seq combining electrophysiology with transcriptomics

    • Single-cell proteomics to analyze expression heterogeneity

    • Spatial transcriptomics for region-specific expression profiles

    • Live-cell metabolomics to link metabolism with channel function

  • Advanced imaging approaches:

    • Super-resolution imaging of channel organization and trafficking

    • Optogenetic control of Kcnj4 activity

    • Genetically encoded voltage indicators for functional mapping

    • Label-free imaging techniques for non-invasive monitoring

  • Artificial intelligence applications:

    • Machine learning for structure-function relationship prediction

    • AI-driven drug discovery targeting Kcnj4

    • Automated patch-clamp data analysis and classification

    • Integration of multi-omics data for systems-level understanding

These technologies will enable researchers to address fundamental questions about Kcnj4 regulation, heteromeric assembly, and tissue-specific functions with unprecedented precision and throughput .

What are the most significant unresolved questions in Kcnj4 research?

Despite significant advances, several critical questions about Kcnj4 remain unresolved:

  • Heteromeric channel composition in vivo:

    • What is the exact stoichiometry of Kcnj4-containing channels in different tissues?

    • How does the composition change during development and in disease states?

    • What mechanisms control preferential assembly with specific Kir2.x subunits?

    • How does heteromeric assembly affect pharmacological responses?

  • Regulatory mechanisms:

    • What is the complete interactome of Kcnj4 in different cell types?

    • How do multiple post-translational modifications interact to fine-tune channel function?

    • What signaling pathways specifically target Kcnj4 versus other Kir2.x channels?

    • How is Kcnj4 trafficking regulated in polarized cells?

  • Physiological and pathophysiological roles:

    • What are the specific contributions of Kcnj4 to cardiac electrophysiology?

    • How does Kcnj4 dysfunction contribute to neurological disorders?

    • What is the role of Kcnj4 in non-excitable tissues?

    • How do Kcnj4 channels contribute to metabolic regulation?

  • Structural dynamics:

    • What are the conformational changes during Kcnj4 gating?

    • How do permeating ions and blockers interact with the channel pore?

    • What is the structural basis of inward rectification in Kcnj4?

    • How does PtdIns(4,5)P2 binding allosterically regulate channel function?

  • Therapeutic targeting:

    • Can Kcnj4-specific modulators be developed?

    • What therapeutic approaches can address Kcnj4 dysfunction in disease?

    • How can heteromeric channels be selectively targeted?

    • What is the therapeutic potential of manipulating Kcnj4 expression?

Addressing these questions will require interdisciplinary approaches combining structural biology, electrophysiology, proteomics, genomics, and computational modeling to fully understand this complex and physiologically important channel .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.