Recombinant Mouse JNK1/MAPK8-associated membrane protein (Jkamp)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse JNK1/MAPK8-Associated Membrane Protein (JKAMP)

Recombinant Mouse JNK1/MAPK8-Associated Membrane Protein (JKAMP), also known as JAMP or C14orf100, is a critical membrane protein involved in regulating JNK1 (MAPK8) signaling. It plays pivotal roles in cellular processes such as stress response, apoptosis, and protein quality control, particularly in endoplasmic reticulum (ER)-associated degradation (ERAD) pathways . The recombinant form is engineered for research use, enabling precise study of its biochemical interactions and therapeutic potential.

Applications in Research and Diagnostics

3.1 Detection via ELISA
Mouse-specific ELISA kits (e.g., MODL00755) enable quantification of JKAMP in serum, plasma, and cell lysates. Key specifications include:

ParameterMouse Kit (MODL00755)Rat Kit (RTDL00598)
Sensitivity0.26 ng/mL0.61 ng/mL
Detection Range0.781–50 ng/mL1.56–100 ng/mL
MatricesTissue homogenates, cell culture supernatants

These kits use sandwich ELISA formats with high intra-assay precision (CV <10%) .

3.2 Antibody-Based Studies
Antibodies targeting JKAMP or JNK1 are used for immunoblotting and immunohistochemistry. For example:

  • Anti-JNK1 antibodies (e.g., clone GH05/4G10) detect JNK1 at ~44/52 kDa in Western blots .

  • Recombinant JKAMP serves as a positive control in assays to validate antibody specificity .

Research Findings and Disease Implications

4.1 Role in Inflammatory Pathways
JKAMP/JNK1 signaling contributes to psoriasis pathogenesis by regulating cytokine production in myeloid cells and keratinocyte proliferation. Studies using Mapk8 knockout mice revealed reduced IL-23 and IL-1β levels, suggesting JKAMP’s role in inflammasome activation .

4.2 ER Stress and Protein Degradation
JKAMP facilitates ERAD by linking misfolded proteins to the proteasome. This function is critical in neurodegenerative diseases, where protein misfolding is a hallmark .

Production and Quality Control

5.1 Recombinant Expression
Mouse JKAMP is produced via bacterial systems with:

ParameterDetails
HostE. coli (prokaryotic)
Purity>90% (SDS-PAGE confirmed)
Storage-80°C (lyophilized) or 4°C (short-term)

5.2 Cross-Reactivity Considerations
ELISA kits may show limited cross-reactivity with analogs, necessitating validation with native proteins .

Challenges and Future Directions

  • Species-Specific Interactions: Rat and human JKAMP orthologs differ in sequence and function, requiring validation for cross-species studies .

  • Therapeutic Targets: JKAMP’s role in ERAD and apoptosis makes it a candidate for cancer or neurodegenerative therapies, though further in vivo studies are needed .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your needs in the order remarks, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your preference.
Synonyms
Jkamp; Jamp; JNK1/MAPK8-associated membrane protein; JKAMP; JNK1-associated membrane protein; JAMP; Medulloblastoma antigen MU-MB-50.4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Jkamp
Target Protein Sequence
MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLY LGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSC RVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIA CGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIEN CYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEP SRILSEGANGH
Uniprot No.

Target Background

Function
JAMP might act as a regulator of MAPK8 activity duration in response to diverse stress stimuli. It facilitates the degradation of misfolded endoplasmic reticulum (ER) luminal proteins by recruiting components of the proteasome and the endoplasmic reticulum-associated degradation (ERAD) system.
Gene References Into Functions
  1. JAMP serves as a membrane-anchored regulator of JNK1 activity duration in response to various stress stimuli [JAMP, a Jun N-terminal kinase 1 (JNK1)-associated membrane protein] PMID: 16166642
  2. JAMP is crucial for the coordinated clearance of misfolded proteins from the endoplasmic reticulum. PMID: 18784250
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in numerous tissues, including brain, spleen, thymus, liver, kidney and testis. Elevated expression in medulloblastoma.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.