Recombinant Mouse Junctional adhesion molecule A (F11r)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

JAM-A/F11R is a transmembrane immunoglobulin superfamily protein with dual roles in cell adhesion and signaling:

Key Functions:

  • Tight Junction Regulation: Mediates epithelial/endothelial barrier formation by recruiting PARD3 and regulating paracellular permeability .

  • Leukocyte Transmigration: Facilitates neutrophil and monocyte migration via LFA-1 integrin binding .

  • Platelet Activation: Triggers aggregation and secretion through interactions with FcγRII .

  • Pathogen Entry: Serves as a receptor for mammalian orthoreoviruses and rotaviruses .

Mechanistic Insights:

  • Proteolytic shedding by ADAM10/17 generates soluble JAM-A, which inhibits neutrophil transmigration and endothelial migration .

  • Dimerization of JAM-A’s membrane-distal Ig-like domain activates Rap1A, enhancing β1 integrin levels and cell migration .

In Vitro Studies

  • Cancer Research:

    • JAM-A blockade disrupts multiple myeloma cell migration, proliferation, and chemotaxis .

    • High JAM-A expression in glioblastoma stem cells correlates with poor prognosis .

  • Thrombosis Models:

    • Soluble JAM-A (sJAM-A) reduces platelet adhesion to inflamed endothelium by 50% via LFA-1 antagonism .

In Vivo Studies

  • Atherosclerosis:

    • F11R antagonists (e.g., peptide 4D) reduce plaque formation in ApoE−/− mice by inhibiting platelet-endothelial interactions .

    • Plasma sJAM-A levels correlate with coronary artery disease severity in humans .

  • Vascular Inflammation:

    • ADAM17-mediated JAM-A shedding increases during cytokine storms, serving as a biomarker for endothelial dysfunction .

Therapeutic Implications

Targeted Pathways and Diseases:

DiseaseMechanismTherapeutic Approach
AtherosclerosisPlatelet adhesion to inflamed endothelium via F11R-F11R homophilic bindingF11R peptide antagonists (e.g., 4D)
Breast CancerJAM-A overexpression drives metastasisAnti-JAM-A antibodies
Inflammatory Bowel DiseaseDysregulated epithelial barrier functionSoluble JAM-A to block leukocyte migration

Technical Considerations for Use

  • Storage: Lyophilized protein stable at -80°C for 1 year; reconstitute in sterile water (0.1–0.5 mg/mL) .

  • Functional Assays:

    • SDS-PAGE validation under reducing conditions .

    • Inhibition of reovirus binding or LFA-1-mediated migration .

Challenges and Future Directions

  • Dual Roles: JAM-A exhibits pro- and anti-tumorigenic effects depending on tissue context .

  • Clinical Translation: Soluble JAM-A’s short half-life necessitates engineered variants for sustained efficacy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, it is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
F11r; Jam1; Jcam; Jcam1; Junctional adhesion molecule A; JAM-A; Junctional adhesion molecule 1; JAM-1; CD antigen CD321
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-300
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV
Uniprot No.

Target Background

Function
Junctional adhesion molecule A (JAM-A) plays a crucial role in epithelial tight junction formation. It appears early in the development of cell junctions and recruits the PARD3 protein. The interaction of the PARD6-PARD3 complex may prevent PARD3 from interacting with JAM1, thus inhibiting tight junction assembly. JAM-A is involved in regulating monocyte transmigration, contributing to the integrity of the epithelial barrier. It acts as a ligand for integrin alpha-L/beta-2, facilitating memory T-cell and neutrophil transmigration. Additionally, JAM-A participates in platelet activation.
Gene References Into Functions
  1. Deletion of JAM-A from platelets increases early-stage neointima formation after carotid artery wire injury in hyperlipidemic mice. PMID: 28211187
  2. JAM-A is present in the prostate and seminal vesicles, as well as all three regions of the epididymis. It is secreted in epididymosomes within the luminal fluid and can be delivered to sperm. PMID: 28062807
  3. Soluble JAM-A secreted from cardiac progenitor cells reduces neutrophil infiltration after myocardial infarction and ameliorates tissue damage by preventing excessive inflammation. PMID: 25468657
  4. Up-regulation of JAM-A enhances the proliferation, cytokine secretion, and wound-homing ability of mesenchymal stem cells (MSCs), accelerating the repair of full-thickness skin defects. PMID: 25994236
  5. Endothelial JAM-A, but not hematopoietic JAM-A, facilitates reovirus T1L bloodstream entry and egress. PMID: 25149763
  6. Deletion of JAM-A results in a gain-of-function in platelets, leading to lower activation thresholds and increased inflammatory activities. This contributes to increased plaque formation, particularly in the early stages of the disease. PMID: 25472975
  7. The F11r gene is directly regulated by retinoic acid in the embryonic mesoderm. PMID: 25251699
  8. Redistribution of JAM-A in endothelial cells after stimulation with pro-atherogenic oxidized lipoproteins leads to increased transmigration of mononuclear cells. PMID: 24704627
  9. JAM-A plays a significant role in regulating leukocyte infiltration after brain ischemia/reperfusion injury and could be a potential target for limiting post-ischemic inflammation. PMID: 24657919
  10. JAM-A regulates epithelial permeability through its association with ZO-2, afadin, and PDZ-GEF1, activating Rap2c and controlling contraction of the apical cytoskeleton. PMID: 23885123
  11. Cancer stem cells selectively express JAM-A, which regulates self-renewal. PMID: 24373972
  12. These studies identify F11R as a novel monocyte prognostic marker for glioblastoma multiforme (GBM), crucial for defining a subpopulation of stromal cells for potential future therapeutic intervention. PMID: 24147027
  13. Our data indicate that endothelial JAM-A is a key effector molecule integrating atherogenic conditions to direct inflammatory cell entry at predilection sites of atherosclerosis. PMID: 24065611
  14. The JAM-A and ZO-1 genes were highly expressed in all the tested tissues. PMID: 23568966
  15. Junctional adhesion molecule-A regulates vascular endothelial growth factor receptor-2 signaling-dependent mouse corneal wound healing. PMID: 23667656
  16. The crucial role of JAM-A in the transmigration of neutrophils from the vasculature into inflamed tissues is evident. PMID: 22904169
  17. The chemokine (C-C motif) ligand 2 (CCL2) induced JAM-A redistribution from the interendothelial cell area to the apical surface of brain endothelial cells. PMID: 22733993
  18. CASK negatively regulates PMCA4b by directly binding to it, and JAM-A positively regulates it indirectly through CASK. PMID: 22020416
  19. JAM-A normally limits platelet accumulation by inhibiting integrin outside-in signaling, thereby preventing premature platelet activation. PMID: 22271446
  20. Data suggest that aPKC phosphorylates JAM-A at S285 to regulate cell-cell contact maturation, tight junction formation, and single lumen specification. PMID: 22371556
  21. Downregulation of JAM-A reduces tumor aggressive behavior by increasing cell susceptibility to apoptosis. PMID: 21695058
  22. Data demonstrate that JAM-A restricts intestinal epithelial cell (IEC) proliferation in a dimerization-dependent manner by inhibiting Akt-dependent beta-catenin activation. PMID: 21372850
  23. Our data show that JAM-A is a novel surface marker for NG2-glia cells of the adult brain. PMID: 20184779
  24. In the Rip1Tag2 tumor model, abrogation of JAM-A reduces cancer development by increasing antitumor immune response. PMID: 20160037
  25. JAM-1 did not contribute to global embryo compaction and adhesion but rather regulated the timing of blastocoel cavity formation dependent upon the establishment of the trophectoderm tight junction paracellular seal. PMID: 15494378
  26. By regulating cytoskeletal and adhesive structures, JAM-A expression prevents cell motility, likely in a PSD95-Dlg-ZO1-dependent manner. PMID: 15657074
  27. JAM-A is expressed in the corneal epithelium where it appears to regulate cell shape. PMID: 17118692
  28. Junctional adhesion molecule-A is critical for the formation of pseudocanaliculi and modulates E-cadherin expression in hepatic cells. PMID: 17623668
  29. JAM-A is expressed on hematopoietic precursors in various hematopoietic tissues. PMID: 17986666
  30. The findings show that JAM-A is involved in sperm tail formation and is essential for normal motility, which may occur through its signal transduction and protein phosphorylation properties. PMID: 18022613
  31. JAM-A plays a role in intestinal homeostasis by regulating epithelial permeability, inflammation, and proliferation. PMID: 18039951
  32. A short bond lifetime imparts a highly dynamic nature to homophilic JAM-A interactions for regulating tight junction permeability, while stable interactions between sigma1 and JAM-A likely anchor the virus to the cell surface and facilitate viral entry. PMID: 18446885
  33. JAM-A plays a nonredundant and novel role in controlling mucosal homeostasis by regulating the integrity and permeability of epithelial barrier function. PMID: 18514073
  34. Nectin plays a novel role in the co-localization of JAM and claudin at the same cell-cell adhesion membrane domains. PMID: 18547333
  35. These data indicate that JAM-A is required for the correct internalization and recycling of integrins during cell migration. PMID: 19118219
  36. The authors inoculated wild-type (WT) and isogenic JAM-A(-/-) mice perorally with reovirus and found that JAM-A is dispensable for viral replication in the intestine but required for systemic dissemination. PMID: 19154988

Show More

Hide All

Database Links
Protein Families
Immunoglobulin superfamily
Subcellular Location
Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein. Note=Localized at tight junctions of both epithelial and endothelial cells.

Q&A

What are the structural domains of mouse F11r/JAM-A and their functional significance?

Mouse F11r/JAM-A contains several critical structural domains:

  • Extracellular region with two immunoglobulin-like domains (amino acids 1-238) involved in homophilic and heterophilic interactions

  • Single transmembrane domain

  • Cytoplasmic region containing phosphorylation sites and a PDZ-binding motif

The extracellular domain appears early in primordial forms of cell junctions and recruits PARD3 . The cytoplasmic region participates in tight junction assembly, intracellular signaling pathways, and cell polarity regulation . Of particular importance, the PDZ-binding motif allows F11r/JAM-A to directly interact with at least nine different PDZ domain-containing proteins , explaining its diverse biological activities despite lacking intrinsic catalytic activity.

Which expression systems provide optimal yield and proper folding for recombinant mouse F11r/JAM-A?

For production of functional recombinant mouse F11r/JAM-A, mammalian expression systems are strongly preferred over bacterial systems because:

  • HEK293 cells: Most commonly used for proper folding and post-translational modifications, especially glycosylation

  • Human cells: Effective for producing Fc-tagged fusion proteins with >94% purity

Methodology for optimal expression:

  • Clone mouse F11r (NP_766235.1) extracellular domain (Met 1-Ala 242) with appropriate tag

  • Transfect expression vector into HEK293 cells using calcium phosphate or lipid-based transfection

  • Harvest supernatant after 48-72 hours

  • Confirm expression in cell lysates by western blot

The choice of expression system significantly impacts protein functionality, particularly for studies examining protein-protein interactions or structural analyses.

What purification strategy yields highest purity and maintains functional integrity of recombinant mouse F11r/JAM-A?

A multi-step purification protocol is recommended:

  • Initial capture: Anti-tag affinity chromatography

    • For His-tagged proteins: Immobilized metal affinity chromatography

    • For Fc-tagged proteins: Protein A/G affinity columns

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality control:

    • SDS-PAGE with Coomassie staining (target >94% purity)

    • Endotoxin testing (<1 EU/μg)

    • Functional verification (binding assays)

Critical considerations include buffer composition (typically 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol) and storage conditions (store at -80°C and avoid repeated freeze-thaw cycles).

How can researchers accurately assess homophilic and heterophilic interactions of mouse F11r/JAM-A?

Several methodological approaches can be employed:

  • Local fluorescent signal correlation analysis:

    • Create a sliding window method to measure local signal correlation

    • Use 9×9 pixel window (1.85×1.85μm) for optimal balance between minimizing noise and maintaining sensitivity

    • Generate correlation maps to analyze recruitment dynamics at adhesion sites

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant JAM-A on a sensor chip

    • Flow potential binding partners at various concentrations

    • Analyze association/dissociation rates to determine binding constants

    • Include cation effects (Ca²⁺, Mg²⁺, etc.) in binding buffer to assess their role as molecular switches

  • Co-immunoprecipitation assays:

    • Examine JAM-A dimerization status following activation

    • Investigate association with binding partners like integrin GPIIIa and CD9

These approaches provide complementary information about JAM-A's diverse molecular interactions and should be combined for comprehensive characterization.

What methodologies are most effective for studying F11r/JAM-A's role in tight junction formation?

To study F11r/JAM-A's role in tight junction assembly:

  • Loss-of-function approaches:

    • Use shRNA to deplete JAM-A in primary epithelial cells

    • Quantify effects on transepithelial resistance (typically 30% decrease in JAM-A-depleted cells)

    • Monitor expression/localization of tight junction scaffold proteins (ZO-1) and structural transmembrane proteins (claudin-18)

  • Rescue experiments:

    • Re-express wild-type or mutant JAM-A in knockdown cells

    • Focus on key domains: PDZ-binding motif, dimerization interface, phosphorylation sites

  • Molecular interaction studies:

    • Investigate JAM-A's recruitment of PARD3 using fluorescence microscopy

    • Examine how PARD6-PARD3 complex affects JAM-A-PARD3 interactions

    • Study JAM-A's direct interaction with ZO-2 and subsequent recruitment of other scaffold proteins (ZO-1, afadin, PDZ-GEF1, Rap2c)

These approaches should be conducted in relevant cell types (epithelial or endothelial) to maintain physiological relevance.

How do cis and trans interactions of mouse F11r/JAM-A differentially regulate downstream signaling pathways?

Distinguishing between cis (same cell) and trans (adjacent cell) interactions requires sophisticated experimental approaches:

  • Mutational analysis:

    • Generate dimerization-deficient mutants that specifically disrupt cis or trans interactions

    • Assess effects on JAM-C replacement by electroporating cDNA with specific mutations

    • Analyze downstream signaling through small GTPases (Rap2c and RhoA)

  • Spatial organization analysis:

    • Calculate spatial distribution of correlation at adhesion periphery

    • Analyze the 0.5 μm edge around JAM adhesions

    • Plot ratio of peripheral to whole adhesion values of correlation and area

    • Higher proportion of positive JAM:drebrin correlation at adhesion periphery indicates peripheral distribution during adhesion formation

  • Biochemical discrimination:

    • Use cross-linking reagents with different spacer arm lengths to distinguish between cis and trans dimers

    • Employ proximity ligation assays to visualize specifically cis or trans interactions in situ

This methodology allows researchers to dissect the specific contributions of different interaction modes to JAM-A's diverse functions.

What experimental approaches can reveal the phosphorylation-dependent regulation of mouse F11r/JAM-A functions?

To investigate phosphorylation-dependent regulation:

  • Site-specific phosphorylation analysis:

    • Focus on key sites in the cytoplasmic region, particularly Tyr280 and Ser284

    • Generate phosphomimetic (D/E substitution) and phosphodeficient (A substitution) mutants

    • Assess effects on:

      • Tight junction assembly

      • Intracellular signaling

      • Cell polarity regulation

  • Kinase identification:

    • For platelet activation, investigate phosphoinositide-3 kinase activity using specific inhibitors like wortmannin

    • Examine F11R dimerization and association with integrin GPIIIa and CD9 following phosphorylation

  • Molecular consequence analysis:

    • Determine how phosphorylation affects interaction with PDZ domain-containing proteins

    • Assess impact on subcellular localization and protein stability

    • Examine phosphorylation status during specific biological processes (e.g., tight junction disassembly during inflammation)

These approaches help elucidate how post-translational modifications regulate F11r/JAM-A's multifunctional capabilities.

What methodologies best evaluate mouse F11r/JAM-A's tissue-specific roles in cancer progression?

F11r/JAM-A shows complex, tissue-specific patterns in cancer as summarized in this data table:

Cancer typeF11R/JAM-A expressionCorrelation with poor prognosis
Breast cancer↓ or ↑+
Gastric cancer
Pancreatic cancer
Lung cancer+
Glioblastoma+
Epithelial ovarian cancer+
Endometrial carcinoma
Multiple myeloma+
Lymphoma+

To investigate these complexities, researchers should employ:

  • Tissue-specific expression modulation:

    • Use inducible, tissue-specific knockout/knockdown models

    • Apply CRISPR/Cas9 to generate cell-type specific mutations

    • Compare effects across multiple cancer types

  • Transendothelial migration (TEM) assays:

    • Utilize F11R/JAM-A antagonistic peptides (e.g., peptide 4D) to block function

    • Measure cancer cell adhesion to endothelium and transendothelial migration

    • Assess soluble F11R/JAM-A (sJAM-A) levels by ELISA as potential biomarkers

  • Mechanistic pathway investigation:

    • Study EMT markers following JAM-A modulation

    • Characterize signaling pathway differences between cancer types

This methodological approach allows reconciliation of apparently contradictory findings across different cancer types.

How can researchers effectively design and evaluate F11r/JAM-A-derived peptides for potential therapeutic applications?

For developing F11r/JAM-A-based therapeutics:

  • Rational peptide design:

    • Identify active site sequences in N-terminal and first Ig-loop regions that mediate homophilic interactions

    • Use in silico modeling of polypeptide chain complexes to predict inhibitory candidates

    • Incorporate D-amino acids (D-Arg, D-Lys) at strategic positions to enhance stability against proteolysis

    • Example: 2HN-(dK)-SVT-(dR)-EDTGTYTC-CONH2 shows promising activity

  • Functional validation assays:

    • Test inhibition of antibody-induced platelet aggregation

    • Evaluate prevention of adhesion to cytokine-inflamed endothelial cells

    • Assess effects on transendothelial migration (TEM) of cancer cells

    • Measure endothelial permeability using fluorescent tracer assays

  • Pharmacological characterization:

    • Determine peptide stability in biological fluids

    • Assess potential off-target effects on normal tight junction function

    • Compare effectiveness with established barrier-protective compounds (e.g., forskolin)

This systematic approach can help develop novel therapeutics targeting atherosclerosis, thrombosis, inflammatory conditions, and cancer metastasis.

What advanced techniques can assess F11r/JAM-A's role in endothelial barrier function during inflammation?

To investigate F11r/JAM-A's role in endothelial barrier function:

  • Real-Time Cell Analysis (RTCA):

    • Monitor endothelial barrier integrity in real-time

    • Assess effects of inflammatory cytokines on barrier function

    • Evaluate the protective effect of F11R/JAM-A-derived peptides

    • Compare effectiveness of peptide 4D (P4D) with established compounds like forskolin

  • Mechanistic dissection:

    • Examine JAM-A's association with PAR-3 and ZO-1 during inflammation

    • Investigate how these interactions affect the cortical actin cytoskeleton

    • Study actomyosin-dependent tension on adherens junctions

    • Monitor junctional localization of JAM-A and tight junction proteins like claudin-5

  • In vivo inflammation models:

    • Use models of mild systemic endotoxemia (LPS injection)

    • Evaluate JAM-A expression and localization during inflammatory response

    • Assess barrier protection by JAM-A-derived peptides

    • Study JAM-A's role in regulating monocyte transmigration and epithelial barrier integrity

These methodologies provide a comprehensive understanding of how F11r/JAM-A regulates endothelial barrier function under inflammatory conditions, offering insights for therapeutic development.

How can researchers accurately characterize the PDZ domain interactions of mouse F11r/JAM-A?

F11r/JAM-A's diverse functions largely depend on interactions with PDZ domain-containing proteins. To study these interactions:

  • Systematic interaction mapping:

    • Use yeast two-hybrid screening with JAM-A's cytoplasmic domain as bait

    • Perform pull-down assays with recombinant PDZ domains

    • Identify which of the nine known PDZ domain interactions are most critical for specific functions

  • Structural biology approaches:

    • Obtain co-crystal structures of JAM-A cytoplasmic domain with PDZ domains

    • Use NMR to characterize dynamic aspects of these interactions

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Functional consequence analysis:

    • Generate specific mutations in the PDZ-binding motif that disrupt interactions with particular PDZ proteins

    • Create chimeric proteins where JAM-A's PDZ-binding motif is replaced with motifs having different specificities

    • Examine effects on tight junction assembly, barrier function, and signaling complex formation

This methodological approach allows precise dissection of how specific PDZ interactions contribute to JAM-A's multiple biological functions.

What experimental strategies can reveal the dynamic assembly of F11r/JAM-A-containing protein complexes during junction formation?

To investigate the temporal dynamics of JAM-A complex assembly:

  • Live-cell imaging approaches:

    • Express fluorescently-tagged JAM-A and partner proteins

    • Use FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics

    • Apply FRET-based sensors to monitor protein-protein interactions in real-time

    • Implement the local correlation analysis within sliding windows as described in the search results

  • Sequential recruitment analysis:

    • Use synchronized junction formation models (calcium switch assays)

    • Collect samples at defined time points for biochemical and microscopic analysis

    • Determine the order of protein recruitment (JAM-A → PARD3 → tight junction proteins)

    • Examine how PARD6-PARD3 complex may prevent PARD3-JAM1 interaction

  • Super-resolution microscopy:

    • Apply techniques like STORM, PALM, or cryo-CLEM to visualize spatial organization at nanoscale resolution

    • Analyze adhesion edge morphology, where JAM-to-drebrin correlation appears highest

    • Study drebrin peripheral distribution during adhesion formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.