Recombinant Mouse Kappa-type opioid receptor (Oprk1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

Oprk1 activation mediates diverse physiological effects:

  • Pain and Itch Modulation: Oprk1-expressing sensory neurons in dorsal root ganglia (DRG) inhibit pain and itch signals via dynorphin binding .

  • Neurotransmitter Regulation: Reduces calcium influx and enhances potassium efflux, suppressing synaptic transmission .

  • Behavioral Responses: Mediates aversion, stress responses, and reward dysregulation in chronic pain models .

In mice, Oprk1 is enriched in peptidergic afferents co-expressing Calcα (CGRP), Tac1 (substance P), and Trpv1, linking it to nociception and neurogenic inflammation .

Research Applications

Recombinant Oprk1 is pivotal in:

  • Drug Development: Screening opioid agonists/antagonists (e.g., nalfurafine, ICI204448) .

  • Mechanistic Studies:

    • Single-cell RT-PCR and in situ hybridization validate receptor distribution in DRG neurons .

    • GTPγS autoradiography and BRET assays quantify G-protein activation and receptor internalization .

  • Behavioral Models: Chronic pain studies show Oprk1 upregulation correlates with dopamine system dysfunction, which KOR antagonists reverse .

Table 1: Species-Specific Functional Differences

ParameterMouse Oprk1Human OPRK1
Agonist EC50 (ICI204448)0.3–0.5 nM (G-protein activation) 0.5–0.8 nM
Internalization KineticsFaster (tmax = 7 min) Slower (tmax = 17 min)
Tissue SpecificityHigh in colon/bladder afferents Predominant in CNS and gut

Notable Insights:

  • Chronic Pain: Oprk1 mRNA increases in mice with peripheral nerve injury (PNI), driving aversion via mesolimbic dopamine suppression .

  • Sex-Dependent Effects: KOR antagonists alleviate anxiety in both sexes but reverse aversion only in males .

  • Translational Challenges: Mouse recombinant receptors overestimate human tissue responses (e.g., asimadoline efficacy) .

Challenges and Future Directions

While recombinant Oprk1 has advanced pain research, species-specific signaling biases and sex dimorphisms complicate therapeutic translation. Future work may leverage cryo-EM structures and conditional knockout models to refine drug targeting.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Oprk1; Kappa-type opioid receptor; K-OR-1; KOR-1; MSL-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MESPIQIFRGDPGPTCSPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLESAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV RNTVQDPASMRDVGGMNKPV
Uniprot No.

Target Background

Function
The kappa-type opioid receptor (KOR) is a G-protein coupled receptor that serves as a receptor for the endogenous peptides alpha-neoendorphins and dynorphins, but exhibits low affinity for beta-endorphins. It also functions as a receptor for various synthetic opioids and the psychoactive diterpene salvinorin A. Ligand binding induces a conformational change, triggering signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. It inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. KOR plays a significant role in pain perception. It also plays a role in mediating reduced physical activity upon treatment with synthetic opioids and in regulating salivation in response to synthetic opioids. KOR may also be involved in arousal and the regulation of autonomic and neuroendocrine functions.
Gene References Into Functions
  1. Our research suggests that stimulation of kappa-opioid receptors in the hippocampus may mitigate cognitive dysfunction by activating the cholinergic system. This finding could offer a potential therapeutic approach for managing symptoms in depression patients. PMID: 29863085
  2. The study indicates that peripheral and central MOR, along with central KOR, might be involved in modulating scratching behavior in mice treated with imiquimod. PMID: 28512665
  3. Chronic KOR activation led to increased phosphorylation of the NR2B subunit of NMDA at tyrosine 1472 (pNR2B NMDA) in the hippocampus, but not in the cortex. PMID: 27634008
  4. Pre- and postsynaptic colocalization of the kappa opioid receptor and D2R supports a role for the kappa opioid receptor in potentiating both the D2R inhibitory autoreceptor function and the inhibitory action of D2R on efferent medium spiny neurons. Co-activation of the kappa opioid receptor accelerates D2R sensitization by contributing to a decrease in dopamine release in the nucleus accumbens. PMID: 28531297
  5. Mechanical allodynia induced by monosodium iodoacetate (MIA) was exacerbated in mice lacking either the KOR or PDYN gene. In contrast to the nociceptive manifestations caused by osteoarthritis, the increased microglial expression in the lumbar section of the spinal cord after MIA administration was similar in KOR-KO, PDYN-KO, and WT littermates. Furthermore, anhedonic- and anxiolytic-like states were observed after MIA administration. PMID: 27567942
  6. The kappa opioid receptor was identified as a key mediator of buprenorphine's effects in tests sensitive to antidepressant drugs in mice. PMID: 26979295
  7. This study provides the first evidence that the neocortical kappa opioid receptor exhibits a time- and learning-dependent property, facilitating the acquisition and consolidation of associative memories. PMID: 28119127
  8. The triazole 1.1 retained the antinociceptive and antipruritic efficacies of a conventional KOR agonist, yet it did not induce sedation or reductions in dopamine release in mice. It also did not produce dysphoria as determined by intracranial self-stimulation. PMID: 27899527
  9. This study reports a cluster of compounds that are highly effective in enhancing remyelination and identifies the kappa-opioid receptor (KOR) as a positive regulator for oligodendroglial differentiation. This suggests that KOR agonism could be a potential strategy to accelerate remyelination. PMID: 27466337
  10. GRK2 upregulation causes kappa-opioid receptor desensitization in the diabetic heart. PMID: 27865836
  11. The study showed that Dyn-A, the endogenous kappa opioid receptor agonist, significantly hyperpolarized and inhibited neurons in the paraventricular nucleus of the mouse thalamus. PMID: 26056031
  12. The findings suggest that mixed cardiac ion channel blockade may mediate the antiarrhythmia actions of the kappa-opioid receptor antagonist PD117,302. PMID: 26086860
  13. The study provides evidence that activation of the kappa opioid receptor (KOR) reduces hyperglycemia in streptozotocin-induced diabetic mice. PMID: 25186835
  14. The kappa-opioid receptor mediates the antinociceptive effect of nitrous oxide in mice. PMID: 25086587
  15. The data from this study provide evidence that KORs on VTA DA neurons are essential for mediating KOR-mediated aversive behavior. PMID: 23921954
  16. Ablation of kappa-opioid receptors from brain dopamine neurons exhibited anxiolytic-like effects. PMID: 23446450
  17. Natural food reward and systemic ghrelin activate Kappa opioid receptors in the ventral tegmental area. PMID: 23220294
  18. Data suggest that activation of neurokinin 3 and kappa-opioid receptors (NK3R and KOR) excites and inhibits kisspeptin, neurokinin B (NKB), and dynorphin (KNDy neurons). PMID: 23744642
  19. Data (including data from KOR knockout mice) suggest that KOR modulates GABAergic synaptic responses in the central amygdala and modulates the effects of ethanol. This is one of multiple opioid system-dependent actions of ethanol in the central amygdala. PMID: 23587526
  20. hKOR activates p38 MAPK through a phosphorylation and arrestin-dependent mechanism. However, activation differs between hKOR and rKOR for some ligands. PMID: 23086943
  21. The data suggests that endogenous prodynorphin-derived peptides adequately activate KOP receptors during acute seizures. Importantly, in situations of reduced dynorphinergic signaling, such as in epilepsy, the exogenous activation of KOP receptors might also exert strong neuroprotective effects during excitotoxic events. PMID: 21391243
  22. Centrally administered apelin-13 elicited depression-like behavior in mice, which was mediated via APJ receptor and kappa-opioid receptor, but not CRF receptor. PMID: 22728209
  23. Repeated stress exposure reduces KOR inhibitory regulation on 5-serotonin (HT) neuronal excitability postsynaptically. PMID: 22956823
  24. The results demonstrate that KOR provides important inhibitory control over presynaptic GABAergic signaling within the bed nucleus of the stria terminalis. PMID: 22225848
  25. Macrophages express kappa opioid receptors, which signal via ERK1/2 phosphorylation and are upregulated by proinflammatory IFN-gamma. PMID: 22424981
  26. The Ro1 model represents a model of communicating hydrocephalus. PMID: 22291910
  27. During stress exposure, kappa-opioid receptor activation is necessary, and kappa-receptor activation in the amygdala alone is sufficient to increase nicotine-seeking behavior as measured by conditioned place preference. PMID: 22279233
  28. Data indicate that the potency and selectivity of the in vitro kappa antagonism were confirmed in the tail-flick analgesia model. PMID: 21744827
  29. The opioid system is a new regulator of vascular development, simultaneously modifying two distinct vascular properties: embryonic cell differentiation and vascular pathfinding. PMID: 21460241
  30. We suggest that NKB and dynorphin act autosynaptically on kisspeptin neurons in the arcuate nucleus to synchronize and shape the pulsatile secretion of kisspeptin and drive the release of gonadotropin-releasing hormone from fibers in the median eminence. [neurokinin B] PMID: 19776272
  31. Ligand-directed c-Jun N-terminal kinase activation disrupts opioid receptor signaling. PMID: 20534436
  32. These results demonstrate that the kappa opioid receptor system has different effects after pIONL in the CNS and PNS. KOR activation promotes CNS astrocytosis and microglial or stem cell proliferation, but inhibits macrophage proliferation in the PNS. PMID: 20109235
  33. The kappa opioid receptor contributes to EGF-stimulated neurite extension during development. PMID: 20133770
  34. Corticotropin Releasing Factor and dynorphin/KOR systems may coordinate stress-induced anxiety behaviors and aversive behaviors through different mechanisms. PMID: 20052275
  35. The kappa opioid receptor binds to Sp1 and inhibits the ERK pathway. PMID: 12171913
  36. A negative regulatory pathway for KOR transcription involves a putative enhancer region in its 3'-UTR. KOR mRNAs using the second poly(A) are more stable than those using the first poly(A). PMID: 12237335
  37. KOR-/- animals produced significantly higher levels of antigen-specific total Ig, IgM, IgG1, and IgG2a antibodies. Endogenous activation of kappa-opioid receptors may exert tonic inhibition of the antibody response. PMID: 12507774
  38. The difference in alcohol preference between B6 and BALB/cJ strains is not correlated with polymorphisms of Oprk1. DBA/2J mice (alcohol-avoiding) show expression of Oprk1 mRNA subtypes (alternatively spliced) that are distinct from B6 and BALB/cJ. PMID: 12657375
  39. No impairment in spatial learning was observed in kappa opioid receptor mutants or in mossy fibers in the CA3 hippocampal region long-term potentiation. PMID: 12884965
  40. The 5'- and 3'-untranslated regions of KOR, either alone or in combination, are capable of mediating transport of mRNAs to processes of P19 embryonal carcinoma neurons and axons of dorsal root ganglia. PMID: 12920195
  41. Collectively, the high potency and efficacy, along with the relative abundance, suggest that Big Dynorphin may play a role in the kappa opioid receptor-mediated activation of G proteins. PMID: 16515546
  42. The present study demonstrated that morphine can produce thermal antinociception via the kappa opioid receptor in the spinal cord, even in the absence of the mu opioid receptor. PMID: 16530171
  43. Opioid modulation of extracellular signal-regulated kinase activity may play a crucial role in embryonic stem cell fate decisions by directing the cells to specific lineages. PMID: 16954126
  44. The study provided evidence that, although kappa opioid receptors can hyperpolarize dopamine neurons, they also suppress dopamine release by direct actions at the release site. PMID: 17122312
  45. The study provided evidence for mRNA transport and regulation of presynaptic protein synthesis of nonstructural proteins like KOR in primary sensory neurons. PMID: 17167054
  46. MOR and KOR are important for skin homeostasis, epidermal nerve fiber regulation, and the pathophysiology of itching. PMID: 17185983
  47. Results support the hypothesis that KOR activation induces spinal astrocyte proliferation, which may contribute to cellular reorganization following sciatic nerve damage. PMID: 17344394
  48. Alterations in kappa opioidergic receptor expression in brain regions may be involved in the long-term consequences of stroke and could be used as biomarkers of neuronal alteration through imaging techniques in clinical settings. PMID: 17676326
  49. Co-treatment with ultra-low-dose naltrexone or nor-binaltorphimine may selectively block signaling by endogenous GM1-sensitized excitatory kappa opioid receptors, unmasking inhibitory kappa opioid receptor signaling. PMID: 17692296
  50. The study provides evidence for a microtubule-dependent, active axonal kappa opioid receptor mRNA-transport process that involves Copb1 and can stimulate localized translation. PMID: 17698811

Show More

Hide All

Database Links

KEGG: mmu:18387

STRING: 10090.ENSMUSP00000027038

UniGene: Mm.7977

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain (at protein level). Brain (neocortex, hippocampus, amygdala, medial habenula, hypothalamus, locus ceruleus, and parabrachial nucleus).

Q&A

What is Kappa-type opioid receptor (Oprk1) and what are its primary functions?

Kappa-type opioid receptor (Oprk1) is a seven transmembrane-spanning G protein-coupled receptor that functions as a receptor for both endogenous ligands and various synthetic opioids. It inhibits neurotransmitter release through two primary mechanisms: reducing calcium ion currents and increasing potassium ion conductance. Oprk1 serves as the primary receptor for dynorphins and plays crucial roles in pain perception, mediating hypolocomotor actions, analgesic effects, and aversive responses to synthetic opioids . Beyond pain modulation, Oprk1 is involved in arousal and the regulation of autonomic and neuroendocrine functions .

How does Oprk1 signaling differ from other opioid receptor subtypes?

Oprk1 signaling differs from other opioid receptor subtypes (mu and delta) primarily in its downstream pathways and physiological effects. While all opioid receptors couple to inhibitory G proteins (Gi/Go) that inhibit adenylate cyclase, Oprk1 specifically activates the adenylate cyclase-inhibiting opioid receptor signaling pathway and phospholipase C-activating G-protein coupled receptor signaling pathway . Unlike mu opioid receptors that produce euphoria, Oprk1 activation typically causes dysphoria and aversion. Functionally, Oprk1 has distinct effects on dopamine secretion, locomotion, and the p38MAPK cascade . Selective antagonists like 5'-GNTI specifically block Oprk1 without significant effects on mu (MOR) or delta (DOR) opioid receptors, demonstrating the pharmacological distinctiveness of this receptor subtype .

What experimental models are commonly used to study Oprk1 function?

Common experimental models for studying Oprk1 function include:

  • Genetically modified mouse models: Oprk1 knockout mice (Oprk1-/-) and conditional knockout models using Cre-loxP systems (e.g., Avil-Cre+/-/Trpa1 fl/fl) that allow tissue-specific deletion .

  • Cell culture systems: Human embryonic kidney 293 (HEK) cells stably transfected with KOR for in vitro functional assays .

  • Primary cultures of dorsal root ganglion (DRG) neurons: Used to study sensory neuron-specific Oprk1 functions and signaling mechanisms .

  • Behavioral models: Including mechanical and cold sensitivity tests, conditioned place preference paradigms, and models of inflammatory and neuropathic pain to assess the functional consequences of Oprk1 activation or inhibition .

These models collectively allow researchers to investigate the molecular, cellular, and behavioral aspects of Oprk1 function across different physiological and pathological contexts.

What are the optimal expression systems for producing recombinant mouse Oprk1?

The optimal expression systems for producing recombinant mouse Oprk1 include:

  • Cell-free expression systems: These provide advantages for transmembrane proteins like Oprk1 by avoiding cellular toxicity issues that often accompany overexpression of GPCRs. They yield functionally active receptor protein suitable for structural and binding studies .

  • Mammalian cell expression systems: HEK293 cells are commonly used for expressing functional recombinant Oprk1, particularly when studying receptor pharmacology and signaling. This system allows proper post-translational modifications and trafficking essential for receptor function .

  • Insect cell/baculovirus systems: These can provide higher yields than mammalian systems while maintaining most post-translational modifications.

When selecting an expression system, researchers should consider factors such as the required protein yield, need for post-translational modifications, planned downstream applications, and whether native signaling partners need to be present. For structural studies or binding assays, cell-free systems may suffice, while functional studies typically benefit from mammalian expression systems.

How can researchers assess Oprk1 activation and signaling in experimental settings?

Researchers can assess Oprk1 activation and signaling through multiple complementary approaches:

  • Inhibition of adenylate cyclase: Measuring decreases in cAMP production following Oprk1 activation using ELISA or biosensor-based assays .

  • G protein coupling assays: Using [35S]GTPγS binding assays to measure activation of G proteins following receptor stimulation.

  • Calcium imaging: Monitoring changes in intracellular Ca2+ levels in response to Oprk1 activation, particularly in neuronal preparations .

  • Electrophysiology: Patch-clamp recording of potassium channel conductance or calcium current inhibition in neurons expressing Oprk1 .

  • Downstream signaling: Detecting phosphorylation of targets like p38MAPK via Western blotting to monitor signaling pathway activation .

  • Behavioral assays: Assessing antinociceptive effects through mechanical threshold tests, cold sensitivity assays, and other pain-related behavioral paradigms, with validation using selective Oprk1 antagonists like 5'-GNTI .

Combining multiple methodologies provides a more comprehensive assessment of Oprk1 function than any single approach and helps validate findings across different experimental contexts.

What are the considerations for designing Oprk1 binding studies?

When designing Oprk1 binding studies, researchers should consider:

  • Receptor preparation: Using membrane preparations from cells expressing recombinant Oprk1 or native tissue preparations like brain homogenates, with careful attention to tissue processing to maintain receptor integrity .

  • Ligand selection:

    • For radioligand binding: [3H]U69,593, [3H]diprenorphine, or [3H]dynorphin are commonly used.

    • For competition binding: Various dynorphin peptides (1-6, 1-7, 1-9, 1-17) or synthetic KOR agonists can be tested .

  • Binding conditions: Optimizing buffer composition, temperature, incubation time, and protein concentration to ensure equilibrium binding while minimizing non-specific binding.

  • Controls and validation:

    • Including selective Oprk1 antagonists (e.g., 5'-GNTI) as controls

    • Testing for cross-reactivity with other opioid receptor subtypes (MOR, DOR) using selective antagonists like naloxonazine (MOR) and naltrindole (DOR) .

  • Data analysis: Applying appropriate mathematical models (one-site binding, two-site binding) and statistical analyses to determine binding parameters (Kd, Bmax, Ki).

Careful attention to these factors ensures reliable and reproducible binding data that accurately reflects Oprk1 pharmacology.

How does TRPA1 modulate Oprk1 activity in sensory neurons?

TRPA1 (Transient Receptor Potential Ankyrin 1) modulates Oprk1 activity in sensory neurons through a previously unrecognized regulatory mechanism. Recent research has revealed that:

  • TRPA1 negatively regulates constitutive Oprk1 activity: Genetic deletion (Trpa1-/-) or pharmacological inhibition of TRPA1 increases the constitutive (basal) activity of Oprk1 in sensory neurons .

  • This increased Oprk1 activity reduces sensory neuron excitability: When TRPA1 is absent or inhibited, the enhanced constitutive activity of Oprk1 decreases neuronal firing in response to mechanical and cold stimuli .

  • The interaction is functionally significant: Administration of the selective KOR antagonist 5'-GNTI completely reverses the reduced mechanical and cold sensitivities in Trpa1-/- mice, restoring sensory function to wild-type levels .

  • The mechanism is specific to KOR: Selective antagonists of mu opioid receptors (naloxonazine) and delta opioid receptors (naltrindole) had little to no effect on the sensory deficits in Trpa1-/- mice .

  • The effect occurs in sensory neurons: Selective deletion of TRPA1 from sensory neurons using conditional knockout mice (Avil-Cre+/-/Trpa1 fl/fl) produces the same phenotype as global TRPA1 deletion, confirming the interaction occurs within sensory neurons .

This novel regulatory relationship between an ion channel (TRPA1) and a G protein-coupled receptor (Oprk1) provides a mechanism for peripherally mediated analgesia and suggests TRP channel regulation of constitutive GPCR activity may be a process of general physiological importance.

What are the challenges in developing selective Oprk1 ligands and how can they be overcome?

Developing selective Oprk1 ligands presents several challenges:

  • Structural similarity among opioid receptors: The high degree of sequence homology in the binding pockets of KOR, MOR, and DOR makes achieving subtype selectivity difficult.

  • Complex ligand-receptor interactions: Kappa agonists can have varying efficacies across different signaling pathways (biased agonism), complicating pharmacological characterization.

  • Species differences: Mouse and human Oprk1 exhibit pharmacological differences that can complicate translational research.

Strategies to overcome these challenges include:

  • Structure-based drug design: Utilizing crystal structures of Oprk1 to identify unique structural features that can be targeted for selective binding.

  • Focused peptide libraries: Developing modified dynorphin-based peptides that enhance KOR selectivity by exploiting subtle differences in the receptor binding pockets .

  • Signaling pathway analysis: Designing ligands with specific signaling bias to activate beneficial pathways (analgesia) while minimizing pathways associated with adverse effects (dysphoria).

  • Species-bridging approaches: Testing lead compounds in both mouse and human Oprk1 systems to identify molecules with conserved pharmacology across species.

  • Combination strategies: Developing peripherally restricted KOR agonists that do not cross the blood-brain barrier, potentially separating analgesic effects from central adverse effects.

These approaches can lead to the development of more selective and clinically useful Oprk1-targeted therapeutics with improved efficacy and side effect profiles.

How can Oprk1 constitutive activity be measured and manipulated in research settings?

Measuring and manipulating Oprk1 constitutive activity requires specialized approaches:

  • Measurement techniques:

    • Inverse agonist assays: Measuring increases in cAMP levels when inverse agonists are applied to systems with constitutively active Oprk1.

    • Basal [35S]GTPγS binding: Quantifying the elevated basal G protein coupling in systems with constitutively active receptors.

    • Spontaneous receptor internalization: Monitoring basal receptor trafficking as an indicator of constitutive activity.

    • Electrophysiological recordings: Measuring tonic effects on neuronal excitability that can be reversed by selective antagonists .

  • Manipulation strategies:

    • Genetic approaches: Using point mutations in specific receptor domains known to alter constitutive activity.

    • Pharmacological tools: Applying inverse agonists (e.g., JDTic) to suppress constitutive activity or neutral antagonists (e.g., 5'-GNTI) to block both agonist-induced and constitutive activity without affecting the latter directly .

    • Modulation of interacting proteins: Manipulating TRPA1 expression or activity to indirectly regulate Oprk1 constitutive activity in sensory neurons .

    • Lipid environment modification: Altering membrane composition to influence receptor conformational equilibrium.

  • Validation approaches:

    • Comparing effects of neutral antagonists versus inverse agonists.

    • Using receptor-null backgrounds to confirm specificity.

    • Testing multiple signaling pathways to assess pathway-specific constitutive activity.

The research on TRPA1 regulation of Oprk1 constitutive activity provides an excellent model system for studying this phenomenon, demonstrating how constitutive KOR activity can be increased by TRPA1 deletion or inhibition, with functional consequences for sensory neuron excitability and pain perception .

How does Oprk1 function differ between acute and chronic pain states?

Oprk1 function undergoes significant adaptations between acute and chronic pain states:

  • Receptor expression and distribution:

    • In acute pain: Oprk1 is primarily expressed in specific neuronal populations in the peripheral and central nervous system.

    • In chronic pain: Upregulation of Oprk1 often occurs in sensory neurons, particularly in inflammatory and neuropathic pain conditions .

  • Signaling adaptations:

    • In acute pain: Oprk1 predominantly couples to inhibitory G proteins, reducing neuronal excitability.

    • In chronic pain: Receptor coupling can shift toward alternative signaling pathways, potentially involving β-arrestin recruitment and altered G protein coupling efficiency.

  • Analgesic efficacy:

    • In acute pain: KOR agonists typically produce moderate analgesia with dysphoric side effects.

    • In chronic pain: Enhanced analgesic efficacy is often observed, particularly for peripherally restricted KOR agonists, possibly due to increased receptor expression and altered signaling dynamics.

  • Interaction with other systems:

    • The TRPA1-Oprk1 regulatory relationship appears particularly significant in chronic pain models, where TRPA1 antagonism produces profound antinociception through enhanced constitutive Oprk1 activity .

These differences highlight the importance of understanding the dynamic nature of Oprk1 function across different pain states and suggest that targeting this receptor may require different approaches in acute versus chronic pain conditions.

What methodological approaches can be used to study Oprk1 function specifically in peripheral pain pathways?

Researchers can use several methodological approaches to study Oprk1 function specifically in peripheral pain pathways:

  • Genetic approaches:

    • Sensory neuron-specific Oprk1 knockout models (e.g., using Advillin-Cre or Nav1.8-Cre)

    • Conditional expression systems to manipulate Oprk1 levels in specific neuronal populations

  • Pharmacological tools:

    • Peripherally restricted KOR agonists that do not cross the blood-brain barrier

    • Local administration of KOR ligands (intraplantar, perineural)

    • Selective KOR antagonists (e.g., 5'-GNTI) to validate KOR-mediated effects

  • Ex vivo preparations:

    • Skin-nerve preparations to record from identified sensory afferents

    • DRG culture systems to study cellular mechanisms in isolated sensory neurons

  • In vivo assessments:

    • Behavioral testing following local drug administration

    • Microdialysis to measure local neurotransmitter release

    • In vivo calcium imaging of peripheral sensory terminals

  • Molecular and cellular assays:

    • Single-cell RNA sequencing to identify Oprk1-expressing neuronal subtypes

    • Co-expression analysis of Oprk1 with other pain-related molecules (e.g., TRPA1)

    • Receptor trafficking studies in sensory neurons

These approaches, used in combination, can provide comprehensive insights into how Oprk1 functions specifically in peripheral pain pathways and how it might be targeted for analgesic development with reduced central side effects.

What quality control measures should be implemented when working with recombinant Oprk1?

Implementing rigorous quality control measures when working with recombinant Oprk1 is essential for experimental reliability:

  • Protein characterization:

    • SDS-PAGE and Western blotting to confirm molecular weight (approximately 43 kDa for the core protein; glycosylated forms may appear larger)

    • Mass spectrometry to verify protein identity and assess post-translational modifications

    • Circular dichroism to evaluate secondary structure, particularly important for transmembrane proteins like Oprk1

  • Functional validation:

    • Ligand binding assays to confirm proper folding and binding pocket integrity

    • G protein coupling assays ([35S]GTPγS binding) to verify signal transduction capability

    • Calcium flux or cAMP inhibition assays to assess downstream signaling

  • Purity assessment:

    • Analytical size exclusion chromatography to evaluate protein homogeneity

    • Endotoxin testing, particularly important for in vivo applications

  • Stability testing:

    • Thermal shift assays to assess protein stability

    • Time-course activity measurements under storage conditions

    • Freeze-thaw stability testing

  • Batch consistency:

    • Implementing lot-to-lot comparison protocols

    • Maintaining reference standards for comparative analysis

Documenting these quality control measures comprehensively ensures experimental reproducibility and facilitates troubleshooting when unexpected results occur.

How can researchers optimize detection sensitivity in Oprk1 assays?

Optimizing detection sensitivity in Oprk1 assays requires attention to several key factors:

  • For ELISA-based detection systems:

    • Use sandwich ELISA formats with high-affinity antibodies specific to Oprk1

    • Optimize antibody concentrations and incubation conditions

    • Consider signal amplification systems (e.g., biotin-avidin) to enhance detection

    • Employ low-background blocking solutions to improve signal-to-noise ratios

  • For functional assays:

    • Use cell lines with optimized receptor expression levels

    • Minimize basal activity in signaling assays by optimizing culture conditions

    • Select high-sensitivity detection reagents (e.g., nano-luciferase reporters for gene expression studies)

    • Consider kinetic rather than endpoint measurements to capture transient signals

  • For binding assays:

    • Use high specific activity radioligands or fluorescent ligands with optimized properties

    • Minimize non-specific binding through buffer optimization

    • Incorporate positive allosteric modulators when studying low-affinity interactions

  • For protein detection:

    • Consider epitope-tagged constructs for consistent detection

    • Use signal enhancement methods for Western blotting or immunocytochemistry

    • Implement image analysis tools for quantitative assessment

Through systematic optimization of these parameters, researchers can achieve detection sensitivities in the subnanomolar range for ligand binding studies and picomolar ranges for functional assays, maximizing the information obtained from limited biological samples.

What considerations are important when transitioning from in vitro to in vivo Oprk1 research?

Transitioning from in vitro to in vivo Oprk1 research requires careful consideration of several factors:

  • Pharmacokinetic properties:

    • Blood-brain barrier penetration: Determining whether compounds should be centrally active or peripherally restricted

    • Metabolism and clearance: Accounting for species differences in drug metabolism when translating doses

    • Bioavailability: Optimizing administration routes based on compound properties

  • Species differences:

    • Receptor pharmacology: Accounting for species-specific differences in ligand binding and signaling

    • Expression patterns: Recognizing that Oprk1 distribution may vary between species

    • Physiological responses: Understanding species-specific behavioral and physiological responses to KOR modulation

  • Experimental design considerations:

    • Appropriate controls: Including both vehicle controls and pharmacological controls (e.g., antagonist reversal studies)

    • Timing: Accounting for onset and duration of drug effects when designing behavioral assessments

    • Sex differences: Including both male and female subjects to identify potential sex-dependent effects

  • Validation approaches:

    • Genetic validation: Using Oprk1 knockout models as controls for pharmacological specificity

    • Dose-response relationships: Establishing full dose-response curves rather than single-dose studies

    • Target engagement: Confirming that compounds reach and engage Oprk1 in target tissues

  • Translational considerations:

    • Predictive validity: Selecting animal models with demonstrated translational relevance

    • Outcome measures: Choosing endpoints that parallel clinical assessments

    • Therapeutic index: Assessing the relationship between efficacy and adverse effects

Careful attention to these factors enhances the predictive value of preclinical Oprk1 research and improves the likelihood of successful translation to clinical applications.

What emerging technologies might advance Oprk1 research in the coming years?

Several emerging technologies are poised to significantly advance Oprk1 research:

  • Structural biology advancements:

    • Cryo-EM for determining Oprk1 structures in various conformational states

    • Computational approaches for modeling ligand-receptor interactions and predicting novel selective ligands

    • Hydrogen-deuterium exchange mass spectrometry for mapping conformational dynamics

  • Genetic and genomic technologies:

    • CRISPR-based approaches for precise genomic manipulation of Oprk1

    • Single-cell transcriptomics to identify and characterize Oprk1-expressing cell populations

    • Spatial transcriptomics to map Oprk1 expression patterns in intact tissues

  • Optical and imaging technologies:

    • Genetically encoded biosensors for real-time visualization of Oprk1 activation and signaling

    • Advanced microscopy techniques for studying receptor trafficking and localization

    • In vivo imaging of Oprk1 activity using PET tracers or optical reporters

  • Tissue engineering approaches:

    • Organoid models incorporating Oprk1-expressing neurons

    • Microphysiological systems ("organs-on-chips") for studying Oprk1 function in tissue contexts

    • 3D bioprinting of neural tissues with defined Oprk1 expression patterns

  • Computational and systems biology:

    • Machine learning for identifying novel Oprk1 ligands

    • Network analysis to understand Oprk1's position in broader signaling networks

    • Pharmacogenomic approaches to identify genetic factors influencing Oprk1 function

These technologies will collectively enhance our understanding of Oprk1 biology and accelerate the development of more effective and selective therapeutics targeting this receptor system.

How might the understanding of TRPA1-Oprk1 interactions inform novel analgesic development?

The newly discovered relationship between TRPA1 and Oprk1 offers several promising avenues for novel analgesic development:

  • Dual-target approaches:

    • Developing compounds that simultaneously inhibit TRPA1 and activate Oprk1

    • Creating bifunctional molecules that incorporate TRPA1 antagonist and KOR agonist pharmacophores

    • Exploring allosteric modulators that enhance the TRPA1-Oprk1 interaction

  • Mechanistic innovations:

    • Designing drugs that specifically enhance Oprk1 constitutive activity rather than binding to the orthosteric site

    • Developing positive allosteric modulators of Oprk1 that are more effective in the absence of TRPA1 activity

    • Creating peripherally restricted compounds that target this interaction specifically in sensory neurons

  • Preclinical development strategies:

    • Prioritizing compounds effective in both inflammatory and neuropathic pain models

    • Screening for reduced central side effects (dysphoria, sedation) while maintaining peripheral analgesic efficacy

    • Identifying biomarkers of TRPA1-Oprk1 interaction that could predict treatment responsiveness

  • Clinical translation considerations:

    • Focusing on pain conditions with known sensory neuron involvement

    • Exploring genetic variations in TRPA1 and OPRK1 that might predict treatment response

    • Developing companion diagnostics to identify patients most likely to benefit from therapies targeting this interaction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.