Keratinocyte-associated protein 2 (KRTCAP2) is a protein-coding gene with roles in various biological functions, including cell recognition, immune response, and signal transduction . It has been identified in several species, including Mus musculus (mouse) and Homo sapiens (human) . Research suggests its involvement in diseases such as gout and cancer, making it a potential therapeutic target .
The mouse Krtcap2 gene encodes a protein of 136 amino acids . The protein sequence is as follows: MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN .
KRTCAP2 is involved in glycosylation, a process crucial for cell recognition, immune response, and signal transduction . It may influence urate production and clearance by modulating the expression and function of xanthine oxidoreductase (XOR) . The regulation of XOR gene expression by KRTCAP2 primarily depends on the modulation of core transcription factors such as Sp1 or PPARγ .
Mendelian randomization analysis has identified KRTCAP2 as a gene associated with gout . Increased expression of KRTCAP2 is associated with an increased risk of gout . KRTCAP2 may affect urate production and clearance by altering the expression and function of xanthine oxidoreductase .
| Gene | P_SMR |
|---|---|
| THBS3 | 4.16 × 10−13 |
| THBS3-AS1 | 1.88 × 10−8 |
| KRTCAP2 | 3.88 × 10−6 |
| KAT5 | 1.70 × 10−5 |
| PGAP3 | 3.24 × 10−5 |
Aberrant MUC1-TRIM46-KRTCAP2 chimeric RNAs have been found in high-grade serous ovarian cancer, suggesting a potential role in cancer development .
KRTCAP2 has homologues in various species. The human KRTCAP2 gene is located on chromosome 1q22 .
Recombinant Mouse Keratinocyte-associated protein 2 is available for research purposes . The protein is expressed in Mus musculus and is available in various sizes . Researchers can access information about KRTCAP2 through databases such as GeneCards, UniProt, and Pharos .
Keratinocyte-associated protein 2 (Krtcap2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the transfer of a specific glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation, a co-translational process. The OST complex associates with the Sec61 translocon complex, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity. Krtcap2 may be involved in N-glycosylation of amyloid-beta precursor protein (APP) and can modulate gamma-secretase cleavage of APP by influencing PSEN1 endoproteolysis.
KRTCAP2, also known as KCP-2, is a protein-coding gene located on chromosome 1 that functions as a critical subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the first step in protein N-glycosylation, transferring specific glycans from lipid carriers to asparagine residues within newly synthesized proteins. The process occurs during protein synthesis, with the OST complex associating with the Sec61 complex to facilitate protein transport across the endoplasmic reticulum. All OST complex subunits, including KRTCAP2, are essential for optimal activity of this glycosylation machinery . KRTCAP2 may specifically influence N-glycosylation of amyloid-beta precursor protein (APP) and potentially affect its cleavage by the gamma-secretase complex, suggesting roles beyond basic structural functions .
The mouse KRTCAP2 protein sequence (AA 1-136) is: "MVVGTGTSLA LSSLLSLLLF AGMQIYSRQL ASTEWLTIQG GLLGSGLFVF SLTAFNNLEN LVFGKGFQAK IFPEILLCLL LALFASGLIH RVCVTTCFIF SMVGLYYINK ISSTLYQATA PVLTPAKITG KGKKRN" . While both mouse and human KRTCAP2 maintain the core functional domains necessary for OST complex participation, researchers should note that sequence differences may affect antibody recognition and potentially alter specific protein-protein interactions in experimental systems. When designing cross-species studies, these variations should be accounted for in experimental design, particularly when using antibody-based detection methods or when investigating binding partners .
Recombinant mouse KRTCAP2 is typically produced using either mammalian expression systems (particularly HEK-293 cells) or cell-free protein synthesis (CFPS) methods . The expression in mammalian systems helps ensure proper folding and post-translational modifications relevant to the native protein. For purification and detection purposes, KRTCAP2 is commonly tagged with epitopes such as His-tag or Strep-tag. Quality of recombinant KRTCAP2 preparations is typically assessed using a combination of methods including SDS-PAGE, Western blot, analytical size exclusion chromatography (SEC/HPLC), and ELISA to confirm identity, purity (typically >70-90%), and functionality . For research requiring high activity, expression systems must be carefully selected to ensure proper glycosylation and folding.
Validation of recombinant mouse KRTCAP2 functionality requires multiple approaches. First, structural integrity should be confirmed via circular dichroism spectroscopy to verify proper protein folding. Second, glycosylation activity assessment is critical and can be performed through in vitro glycosylation assays using known KRTCAP2 substrates. Third, researchers should verify OST complex incorporation capability by co-immunoprecipitation experiments with other OST complex components . Finally, cell-based functional assays can evaluate whether the recombinant protein influences relevant cellular processes such as protein glycosylation patterns when introduced to KRTCAP2-deficient cell lines. Only after confirming these parameters should researchers proceed with mechanistic studies to avoid experimental artifacts from improperly folded or non-functional protein preparations.
Based on protocols for similar recombinant proteins, researchers should store recombinant mouse KRTCAP2 at -80°C for long-term storage, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein integrity . For short-term storage (1-2 weeks), 4°C is generally suitable when the protein is maintained in an appropriate buffer system containing glycerol (typically 10-20%) and protease inhibitors. Stability studies should include regular assessment of protein functionality using activity assays rather than relying solely on physical presence via Western blot analysis. Many researchers employ thermal shift assays to determine optimal buffer conditions that maximize protein stability. When designing experiments, it's advisable to include freshly thawed protein controls alongside stored preparations to detect any functional deterioration.
When using recombinant mouse KRTCAP2 as a Western blot control, researchers should load a concentration range (typically 5-100 ng) to establish a standard curve for quantification of endogenous protein . The recombinant protein should be run alongside experimental samples and transferred under identical conditions. For detection, both tag-specific antibodies (when using tagged recombinant protein) and protein-specific antibodies should be employed in parallel blots to distinguish between detection of the tag versus the protein itself. This approach helps identify potential cross-reactivity issues. Researchers should also prepare control lysates from cells with confirmed KRTCAP2 expression levels (both high and low/negative) to validate antibody specificity and establish expected molecular weight accounting for potential post-translational modifications absent in certain recombinant preparations .
Recent studies indicate that KRTCAP2 expression significantly impacts immune cell populations within tumor microenvironments. High KRTCAP2 expression correlates with lower proportions of CD8+ T cells and CD68+ macrophages in the stromal region of hepatocellular carcinoma (HCC), and fewer CD8+ T cells within tumor regions . Experimentally, introducing recombinant KRTCAP2 to tumor models allows researchers to assess whether these immunological changes are directly influenced by the protein. The inverse relationship observed between KRTCAP2 expression and programmed cell death ligand-1 in HCC suggests potential interference with immune checkpoint mechanisms . Researchers investigating cancer immunotherapy should consider KRTCAP2 expression analysis as part of immunophenotyping, as low KRTCAP2 expression groups demonstrated stronger predictive ability for response to immune checkpoint inhibitors, highlighting its potential as a biomarker for immunotherapeutic responsiveness .
Contradictory findings regarding KRTCAP2 function across cell types likely stem from context-dependent protein interactions and cell-specific signaling pathways. To resolve these contradictions, researchers should employ a systematic approach combining:
Cell type-specific interactome analysis using proximity labeling methods (BioID or APEX)
Parallel knockdown/overexpression studies across multiple cell lineages
Conditional expression systems to control timing of KRTCAP2 expression/suppression
Comprehensive PTM profiling of KRTCAP2 across cell types
For instance, while KRTCAP2 suppression in multiple myeloma cell lines with 1q21 amplification induced significant apoptosis and DNA damage, these effects were notably absent in cell lines without such amplification . This suggests amplification status creates context-dependent vulnerability. Similarly, differential effects between keratinocytes and hepatocellular cells may reflect tissue-specific binding partners or compensatory mechanisms that should be systematically mapped through interaction studies and comparative transcriptomics.
To study KRTCAP2's role in the N-glycosylation of specific targets like APP, researchers should employ a multi-faceted approach combining recombinant protein technology with glycoproteomics. This strategy includes:
| Experimental Approach | Application | Key Controls |
|---|---|---|
| In vitro glycosylation assays | Direct assessment of glycan transfer | Heat-inactivated KRTCAP2, OST complex without KRTCAP2 |
| Site-directed mutagenesis | Identification of critical residues for function | Conserved vs. non-conserved amino acid substitutions |
| Glycoproteomic analysis | Global identification of KRTCAP2-dependent glycosylation sites | KRTCAP2 knockdown vs. overexpression conditions |
| CRISPR-edited cell lines | Validation in physiological context | Multiple independent clones, rescue experiments |
Researchers should pay particular attention to KRTCAP2's association with the Sec61 complex during protein synthesis, potentially using fluorescently tagged recombinant KRTCAP2 in live-cell imaging to visualize its dynamics during glycosylation . Pulse-chase experiments with glycosylation-sensitive reporter constructs can further elucidate temporal aspects of KRTCAP2-mediated glycosylation processes.
When designing KRTCAP2 knockdown studies, researchers must carefully consider several methodological aspects. First, selection of appropriate control conditions is essential - both scrambled sequences and non-targeting controls should be employed to distinguish between specific KRTCAP2 depletion effects and general responses to RNA interference machinery activation. Second, validation of knockdown efficiency should be performed at both mRNA (RT-qPCR) and protein (Western blot) levels, as post-transcriptional regulation may result in discrepancies . Third, researchers should be aware that complete KRTCAP2 depletion may trigger compensatory upregulation of functionally related proteins within the OST complex. Fourth, the timing of phenotypic assessments is critical, as early effects may represent direct consequences of KRTCAP2 loss, while later effects might reflect downstream adaptations or secondary responses. Finally, researchers should consider cell type-specific dependencies on KRTCAP2, as evidenced by the differential responses observed in multiple myeloma cell lines with and without 1q21 amplification .
Interpreting glycosylation pattern changes following KRTCAP2 manipulation requires sophisticated analytical approaches. Researchers should employ multiple complementary techniques including lectin arrays, mass spectrometry-based glycoproteomics, and fluorophore-assisted carbohydrate electrophoresis (FACE) to comprehensively characterize glycosylation changes . When analyzing results, it's important to distinguish between direct effects on N-glycosylation (KRTCAP2's primary function) and potential secondary effects on other glycosylation pathways that may arise from cellular stress responses or altered protein trafficking. Changes should be categorized as: (1) site occupancy alterations (presence/absence of glycans), (2) glycan composition changes, or (3) glycan branching pattern modifications. Temporal dynamics of these changes should be tracked, as acute responses may differ from long-term adaptations. Finally, researchers should correlate glycosylation changes with functional outcomes using rescue experiments with wild-type or mutant KRTCAP2 to establish causality.
When using recombinant mouse KRTCAP2 in cell culture experiments, multiple controls are essential to ensure valid interpretation of results:
Denatured recombinant protein control - to distinguish between structural-dependent and independent effects
Tag-only control - when using tagged recombinant KRTCAP2, to identify tag-mediated artifacts
Species-matched controls - particularly important when using mouse KRTCAP2 with human cell lines
Dose-response assessments - to identify potential concentration-dependent effects that may not reflect physiological conditions
Timing controls - short vs. long exposure to distinguish between acute responses and adaptation
Additionally, researchers should verify cellular uptake or surface binding of recombinant KRTCAP2 using fluorescently labeled protein or immunocytochemistry, as well as confirm subcellular localization patterns that align with expected biological activity . When investigating interactions with other proteins, competition assays with unlabeled protein can help establish specificity of observed interactions.
Recent findings regarding KRTCAP2's inverse relationship with programmed cell death ligand-1 expression and its correlation with tumor-infiltrating immune cell populations in HCC suggest promising applications in cancer immunotherapy research . Investigators can leverage recombinant KRTCAP2 to modulate the tumor immune microenvironment in experimental models through several approaches. First, developing KRTCAP2-based biomarkers for immunotherapy response prediction by correlating KRTCAP2 levels with treatment outcomes across cancer types. Second, exploring combination therapies that target KRTCAP2 expression alongside immune checkpoint inhibitors to potentially enhance treatment efficacy in resistant tumors. Third, investigating whether KRTCAP2-mediated N-glycosylation directly affects immune receptor glycosylation patterns and subsequent immune cell activation or inhibition. The immunophenoscore analysis showing stronger prediction of immune checkpoint inhibitor response in low KRTCAP2 expression groups provides a foundation for these investigations . Researchers should design studies that specifically address whether KRTCAP2 inhibition could sensitize resistant tumors to immunotherapy treatments.
To investigate KRTCAP2's role in APP processing and its potential implications for neurodegenerative diseases, researchers should implement a multi-faceted experimental approach. In vitro glycosylation assays using recombinant KRTCAP2 and APP can establish direct biochemical relationships . Cell-based models expressing wild-type or glycosylation-site mutant APP variants in KRTCAP2-modulated backgrounds can demonstrate functional consequences. Researchers should quantify both γ-secretase and β-secretase-mediated APP cleavage products using ELISA or Western blot analysis to determine if KRTCAP2-dependent glycosylation alters processing pathways. Primary neuronal cultures from KRTCAP2 knockout or transgenic mice can provide physiologically relevant contexts for these studies. Additionally, mass spectrometry analysis of APP glycopeptides under different KRTCAP2 expression conditions can map specific glycosylation sites affected by KRTCAP2 activity. These approaches together will help determine whether KRTCAP2 represents a potential therapeutic target for conditions involving aberrant APP processing.
Recombinant KRTCAP2 degradation is a common challenge that can compromise experimental outcomes. To address this issue, researchers should implement several stabilization strategies. Optimizing buffer composition is critical - adding stabilizing agents such as glycerol (10-20%), reducing agents (1-5 mM DTT or β-mercaptoethanol), and protease inhibitor cocktails can significantly improve stability . Temperature management during experimental procedures is equally important; maintaining samples at 4°C whenever possible and minimizing freeze-thaw cycles by preparing single-use aliquots can prevent degradation. For particularly sensitive applications, researchers might consider protein engineering approaches, such as introducing stabilizing mutations or using fusion partners known to enhance stability. Pre-experiment quality control assessments using size exclusion chromatography or dynamic light scattering can identify aggregation or degradation before experimental use . When degradation cannot be avoided, researchers should consider time-course experiments that account for protein half-life and interpret results accordingly.
Poor solubility of recombinant KRTCAP2 can significantly impair experimental progress. To overcome this challenge, researchers should systematically optimize solubilization conditions through screening different buffer systems (HEPES, Tris, phosphate) across a pH range (typically 6.0-8.5), and testing various salt concentrations (50-500 mM NaCl) to identify optimal conditions . For transmembrane domain-containing proteins like KRTCAP2, inclusion of mild detergents (0.01-0.1% Triton X-100, CHAPS, or DDM) can dramatically improve solubility while maintaining native-like structure. Alternative approaches include expressing truncated constructs that remove particularly hydrophobic regions while preserving functional domains, or utilizing solubility-enhancing fusion partners such as MBP, SUMO, or thioredoxin. If aggregation occurs during refolding from inclusion bodies, gradual dialysis with decreasing denaturant concentration and the presence of chemical chaperones like arginine or trehalose can promote proper folding. Finally, co-expression with interacting partners from the OST complex may improve solubility by stabilizing native conformations.
The most promising future research directions for KRTCAP2 lie at the intersection of its glycosylation functions and disease applications. First, the correlation between KRTCAP2 expression and immune cell infiltration in tumors opens avenues for immunotherapy biomarker development and potential therapeutic targeting . Second, exploring KRTCAP2's role in APP processing may yield insights relevant to neurodegenerative disease interventions . Third, the vulnerability of multiple myeloma cells with 1q21 amplification to KRTCAP2 depletion suggests potential for precision oncology applications . Future research should focus on developing selective KRTCAP2 modulators, establishing comprehensive glycosylation target profiles across tissues, and validating KRTCAP2-based biomarkers in clinical cohorts. The development of conditional knockout mouse models will be invaluable for understanding tissue-specific functions and potential toxicities of KRTCAP2 modulation. Integration of glycoproteomics with systems biology approaches will likely reveal new functional connections between KRTCAP2-mediated glycosylation and cellular signaling networks with significant translational implications.