Recombinant Mouse Killer cell lectin-like receptor subfamily G member 2 (Klrg2)

Shipped with Ice Packs
In Stock

Description

General Information

Killer cell lectin-like receptor G2 (KLRG2) is a protein-coding gene . KLRG2 belongs to the killer cell lectin-like receptor (KLR) family of proteins. These proteins are expressed predominantly on late-differentiated effector and effector memory CD8+ T and NK cells . The KLRG family of receptors are encoded within the natural killer gene complex (NKC) .

Ligand Binding and Function

KLRG1, a related inhibitory receptor, binds to classical cadherins like E-, N-, and R-cadherins, preventing lysis of target cells expressing E-cadherin . KLRG1 is a co-inhibitory receptor that inhibits the activity of T and NK cells . Antibody-mediated ligation of KLRG1 inhibits the release of inflammatory mediators .

KLRG2 in Disease

Genetic variants in the KLRG2 gene may impact Gleason score at diagnosis and thus the aggressiveness of prostate cancer .

Expression

In mice, KLRG1 is expressed on subsets of NK cells, and viral infections can increase the percentage of KLRG1-expressing NK cells . KLRG1 expression is upregulated in mouse CD8 T cells following viral infection .

Role as Co-inhibitory Receptor

KLRG1 acts as an immune checkpoint receptor . Immune checkpoint receptors such as KLRG1, inhibit the activity of T and NK cells .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Klrg2; Killer cell lectin-like receptor subfamily G member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Klrg2
Target Protein Sequence
MEPPQVPAEAPQPRASEDSPRPERTGWEEPDAQPQELPEKSPSPALSGSPRVPPLSLGYG AFRRLGSCSRELPSPSPSWAEQPRDGEAELEPWTASGEPAPASWAPVELQVDVRVKPVGA AGASRAPSPAPSTRFLTVPVPESPAFARRSAPTLQWLPRAPSPGSTWSRGSPLAANATES VSPAEGCMVPPGSPACRCRCREPGLTKEDDALLQRAGIDGKKLPRAITLIGLPQYMKSLR WALVVMAVLLAVCTVAVVALASRGGTKCQPCPQGWMWSQEQCYYLSEEAQDWEGSQAFCS AHHATLPLLSHTQDFLRKYRITKGSWVGARRGPEGWHWTDGVPLPYQLFPADSEDHPDFS CGGLEEGRLVALDCSSPRPWVCARETK
Uniprot No.

Target Background

Database Links

UniGene: Mm.121859

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is KLRG2 and what are its key molecular characteristics?

KLRG2 (Killer Cell Lectin Like Receptor G2) is a protein-coding gene that belongs to the C-type lectin-like receptor family. It is predicted to enable carbohydrate binding activity and is an integral component of cell membranes . KLRG2 shares approximately 25% amino acid sequence identity with other type II lectin-like proteins encoded by genes within the natural killer complex . This receptor is structurally related to NKG2D but serves distinct immunological functions.

The protein contains characteristic domains of C-type lectins including:

  • A type II transmembrane domain

  • An extracellular C-type lectin-like domain

  • Conserved cysteine residues involved in disulfide bond formation

Several aliases exist for this gene, including CLEC15B (C-Type Lectin Domain Family 15 Member B) and FLJ44186, which should be noted when conducting literature searches .

How does KLRG2 differ from other killer cell lectin-like receptors?

While KLRG2 belongs to the same superfamily as other killer cell lectin-like receptors, it has distinct functional and structural properties. Unlike the well-characterized NKG2D receptor, which forms disulfide-linked homodimers and associates with the DAP10 adapter protein to deliver activating signals in NK cells and T cell subsets , KLRG2 has a different signaling mechanism.

KLRG2 is primarily involved in:

  • Signal transduction pathways including JAK/STAT and MAPK-ERK1/2

  • Regulation of cell proliferation, migration, and invasion

  • Cell cycle progression and apoptosis regulation

These distinct functions differentiate KLRG2 from other family members that primarily mediate NK cell recognition and activation against transformed or infected cells.

What expression patterns does KLRG2 exhibit in normal mouse tissues?

  • Immune cells, particularly those of lymphoid lineage

  • Specific epithelial tissues

  • Cells involved in immunological surveillance

Expression levels may vary significantly across tissues and developmental stages. Researchers should conduct tissue-specific expression profiling using techniques such as qRT-PCR, immunohistochemistry, or RNA-seq to establish baseline expression before proceeding with functional studies.

What signaling pathways are modulated by KLRG2 in cancer models?

Recent research has identified KLRG2 as a significant modulator of key oncogenic signaling pathways. KLRG2 knockdown in gastric cancer cells demonstrated substantial effects on multiple signaling cascades:

Signaling PathwayEffect of KLRG2 KnockdownDownstream Consequences
JAK/STATDecreased activationReduced proliferation signals
MAPK-ERK1/2Suppressed activityInhibited cell migration and invasion
p53Upregulated activityEnhanced apoptosis and cell cycle arrest
p38 MAPKIncreased activationPromoted stress response and cell cycle control

KLRG2 appears to function as a critical regulator of these pathways, with knockdown experiments demonstrating that its suppression leads to decreased cell proliferation, migration, and invasion, as well as cell cycle arrest in G2/M phase and enhanced apoptosis via caspase activation . This suggests KLRG2 may serve as a molecular switch controlling multiple oncogenic pathways simultaneously.

How does KLRG2 methylation status correlate with disease phenotypes?

DNA methylation analysis has revealed significant associations between KLRG2 methylation patterns and disease states, particularly in pancreatic ductal adenocarcinoma (PDAC). Research has identified specific CpG sites within the KLRG2 gene region that exhibit distinctive co-methylation patterns:

CpG SiteLocationCorrelation with PDACStatistical Significance
cg155061575'-end CpG islandHypermethylatedSignificant
cg00699934KLRG2 gene regionPositively correlatedSignificant
cg00919016KLRG2 gene regionPositively correlatedSignificant
cg05224190KLRG2 gene regionPositively correlatedSignificant

These methylation markers demonstrate remarkable diagnostic potential. While cg15506157 alone showed good diagnostic capability (contributing to an AUC of 0.905 when combined with another marker), a panel of all four KLRG2 CpG sites yielded an AUC of 0.934 for distinguishing PDAC from chronic pancreatitis . This suggests epigenetic regulation of KLRG2 may play a crucial role in disease pathogenesis and could serve as a valuable biomarker.

What experimental approaches effectively measure KLRG2 functional activity?

To thoroughly evaluate KLRG2 functional activity, researchers should employ multiple complementary approaches:

  • Gene Manipulation Studies:

    • siRNA-mediated knockdown to assess loss-of-function effects

    • CRISPR/Cas9 genome editing for complete knockout

    • Overexpression studies using recombinant vectors

  • Cellular Phenotype Assays:

    • Proliferation assays (e.g., MTT, BrdU incorporation)

    • Migration and invasion assays (transwell, wound healing)

    • Cell cycle analysis by flow cytometry

    • Apoptosis detection (Annexin V/PI staining, TUNEL assay)

  • Signaling Pathway Analysis:

    • Western blotting for phosphorylated and total proteins in JAK/STAT and MAPK pathways

    • Immunoprecipitation to identify protein-protein interactions

    • Luciferase reporter assays for transcriptional activity

  • In vivo Models:

    • Xenograft models to assess tumor formation and metastasis

    • Peritoneal dissemination models for metastatic potential

    • Transgenic mouse models with altered KLRG2 expression

When designing these experiments, it is essential to include appropriate controls and validate findings using multiple independent methods to ensure robust and reproducible results.

What are the optimal conditions for expressing recombinant mouse KLRG2 in mammalian systems?

For optimal expression of recombinant mouse KLRG2 in mammalian systems, researchers should consider the following methodological approaches:

  • Expression Vector Selection:

    • Use vectors with strong promoters (CMV, EF1α) for high expression

    • Include appropriate tags (His, FLAG, Fc) for detection and purification

    • Consider inducible expression systems for temporal control

  • Host Cell Selection:

    • HEK293T cells typically provide high transfection efficiency and protein yield

    • CHO cells are preferred for stable expression and proper glycosylation

    • Mouse cell lines (e.g., NIH/3T3) may provide more native post-translational modifications

  • Transfection and Expression Parameters:

    • Optimize transfection reagent:DNA ratio

    • Culture at 32-37°C with 5% CO2

    • Harvest 48-72 hours post-transfection for transient expression

    • For Fc chimera proteins, similar to the NKG2D Fc chimera approach, consider serum-free media during expression phase

  • Purification Strategy:

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography for final polishing

    • Buffer optimization to maintain protein stability (typically PBS with 5-10% glycerol)

The protocol should be validated by SDS-PAGE, Western blotting, and functional assays to confirm that the recombinant protein maintains its native conformation and activity.

How can researchers effectively design knockdown experiments to study KLRG2 function?

When designing knockdown experiments to study KLRG2 function, researchers should implement the following methodological framework:

  • siRNA Design and Selection:

    • Design 3-4 different siRNA sequences targeting different regions of KLRG2 mRNA

    • Use algorithms to predict efficiency and minimize off-target effects

    • Include scrambled siRNA and non-targeting controls

  • Transfection Optimization:

    • Determine optimal cell density (typically 50-70% confluence)

    • Titrate siRNA concentration (typically 10-50 nM)

    • Validate knockdown efficiency by qRT-PCR and Western blot at multiple time points (24, 48, 72 hours)

  • Functional Readouts:

    • Based on existing research, measure:

      • Cell proliferation using real-time monitoring systems

      • Migration and invasion using transwell assays

      • Cell cycle distribution by flow cytometry

      • Apoptosis via caspase activation assays and Annexin V staining

      • Pathway activation by analyzing phosphorylation of JAK/STAT and MAPK components

  • Controls and Validation:

    • Rescue experiments by expressing siRNA-resistant KLRG2 construct

    • Use multiple siRNA sequences to confirm phenotype consistency

    • Validate key findings with alternative approaches (e.g., CRISPR/Cas9)

This comprehensive approach ensures robust and reproducible results while minimizing the risk of misinterpreting data due to off-target effects or incomplete knockdown.

What analytical techniques best characterize KLRG2 methylation patterns in tissue samples?

For optimal characterization of KLRG2 methylation patterns in tissue samples, researchers should employ these advanced analytical techniques:

  • Bisulfite Conversion and Sequencing:

    • Bisulfite conversion of genomic DNA

    • PCR amplification of KLRG2 promoter and gene body regions

    • Next-generation sequencing to obtain single-base resolution

    • Analysis of co-methylation patterns across CpG sites

  • Targeted Methylation Analysis:

    • Focus on specific CpG sites (cg15506157, cg00699934, cg00919016, cg05224190)

    • Design primers flanking these sites for bisulfite PCR

    • Pyrosequencing or digital droplet PCR for quantitative assessment

  • Genome-wide Methylation Profiling:

    • Illumina methylation arrays for comprehensive CpG coverage

    • Identify differentially methylated regions (DMRs) in the KLRG2 locus

    • Create correlation matrices to visualize co-methylation patterns

  • Data Analysis and Interpretation:

    • Implement appropriate statistical methods for comparing disease vs. normal samples

    • Calculate receiver operating characteristic (ROC) curves and area under curve (AUC)

    • Integrate methylation data with expression data when available

    • Apply machine learning algorithms for classification and biomarker validation

This analytical framework enables precise characterization of KLRG2 methylation patterns and their correlation with disease phenotypes, as demonstrated in pancreatic cancer research where specific methylation signatures achieved an AUC of 0.934 for disease classification .

How should researchers interpret conflicting data on KLRG2 expression across different experimental platforms?

When facing conflicting KLRG2 expression data across different experimental platforms, researchers should implement this systematic interpretation framework:

  • Platform-Specific Considerations:

    • RNA-seq: Account for read depth, splice variants, and normalization methods

    • Microarrays: Consider probe design, cross-hybridization, and dynamic range limitations

    • qRT-PCR: Evaluate primer efficiency, reference gene stability, and amplification specificity

    • Protein detection: Assess antibody specificity, epitope accessibility, and post-translational modifications

  • Sample-Specific Variables:

    • Cell/tissue heterogeneity: Single-cell vs. bulk analysis

    • Experimental conditions: Stress, growth factors, cell density

    • Genetic background: Strain differences in mouse models

    • Temporal dynamics: Expression changes during development or disease progression

  • Validation Strategy:

    • Employ orthogonal techniques to measure expression

    • Use multiple antibodies/probes targeting different regions of KLRG2

    • Include appropriate positive and negative controls

    • Perform functional assays to correlate expression with biological activity

  • Data Integration Approach:

    • Weight evidence based on methodological robustness

    • Apply meta-analysis techniques for quantitative integration

    • Prioritize direct measurements over inferred expression

    • Consider biological context when interpreting results

What statistical approaches best detect meaningful correlations between KLRG2 status and clinical outcomes?

For detecting meaningful correlations between KLRG2 status and clinical outcomes, researchers should implement these statistical approaches:

By employing these rigorous statistical approaches, researchers can confidently identify clinically relevant associations between KLRG2 status and patient outcomes while minimizing spurious correlations.

How can genomic and proteomic data be integrated to build comprehensive models of KLRG2 function?

Integrating genomic and proteomic data to build comprehensive models of KLRG2 function requires a sophisticated multi-omics approach:

  • Data Collection and Preprocessing:

    • Genomic data: Whole genome/exome sequencing, RNA-seq, ChIP-seq, ATAC-seq

    • Epigenomic data: DNA methylation profiles, histone modification patterns

    • Proteomic data: Mass spectrometry, protein arrays, PTM analysis

    • Interactomic data: Co-immunoprecipitation, yeast two-hybrid, proximity labeling

    Each dataset should undergo platform-specific quality control and normalization.

  • Multi-omics Integration Methods:

    • Correlation networks: Identify relationships between molecular features

    • Pathway enrichment analysis: Map data to known biological processes

    • Causal inference models: Establish directionality of relationships

    • Machine learning approaches: Identify complex patterns across data types

  • Functional Validation Framework:

    • Hypothesis generation from integrated models

    • Experimental validation of key predictions

    • Iterative refinement of models based on new data

    • In silico perturbation analysis to predict system responses

  • Application to KLRG2 Research:

    • Integrate methylation data from the KLRG2 promoter with expression levels

    • Correlate KLRG2 protein abundance with activation states of downstream pathways

    • Map KLRG2 interaction partners to cellular processes

    • Model how genetic or epigenetic alterations affect KLRG2-dependent phenotypes

This integrated approach has already yielded insights in cancer research, where KLRG2 knockdown affects multiple signaling pathways (JAK/STAT, MAPK-ERK1/2, p53, p38 MAPK) , and where DNA methylation patterns in the KLRG2 gene region correlate with disease states . Building on these findings, comprehensive multi-omics models can provide a systems-level understanding of KLRG2's role in normal physiology and disease.

What are the most promising therapeutic strategies targeting KLRG2 for cancer treatment?

Based on recent findings linking KLRG2 to aggressive cancer phenotypes, several therapeutic strategies show particular promise:

  • RNA Interference Approaches:

    • siRNA delivery systems targeting KLRG2 mRNA

    • Short hairpin RNA (shRNA) for stable knockdown

    • Antisense oligonucleotides to block KLRG2 expression

    These approaches are supported by evidence that KLRG2 knockdown in gastric cancer cells decreased proliferation, migration, invasion, and induced apoptosis .

  • Small Molecule Inhibitors:

    • Compounds targeting the lectin-binding domain of KLRG2

    • Inhibitors of downstream signaling pathways (JAK/STAT, MAPK-ERK1/2)

    • Molecules disrupting protein-protein interactions

  • Antibody-Based Therapies:

    • Blocking antibodies against extracellular domains

    • Antibody-drug conjugates for targeted delivery

    • Bispecific antibodies linking immune effectors to KLRG2-expressing cells

  • Epigenetic Modulation:

    • DNA methyltransferase inhibitors to reverse hypermethylation

    • Targeted epigenetic editing using CRISPR-Cas systems

    • Combination approaches targeting multiple epigenetic marks

In experimental models, KLRG2 knockdown significantly reduced the number and weight of disseminated gastric cancer nodules in mouse xenograft models of peritoneal metastasis , suggesting that therapeutic strategies targeting KLRG2 could effectively inhibit metastatic spread in patients with advanced disease.

How can KLRG2 methylation signatures be implemented as diagnostic or prognostic tools?

Implementation of KLRG2 methylation signatures as clinical tools requires a structured approach:

  • Assay Development and Validation:

    • Design PCR primers for key CpG sites (cg15506157, cg00699934, cg00919016, cg05224190)

    • Develop rapid bisulfite-based quantitative assays

    • Establish reference ranges and thresholds for clinical interpretation

    • Validate assay performance metrics (sensitivity, specificity, reproducibility)

  • Clinical Validation Strategy:

    • Prospective studies in target patient populations

    • Comparison with current diagnostic standards

    • Assessment of prognostic value using survival endpoints

    • Evaluation in diverse patient cohorts to ensure generalizability

  • Implementation in Clinical Workflows:

    • Integration with existing molecular diagnostic platforms

    • Development of interpretive algorithms and reporting templates

    • Quality control procedures for clinical laboratories

    • Training programs for pathologists and clinical scientists

  • Clinical Utility Assessment:

    • Impact on clinical decision making

    • Cost-effectiveness analysis

    • Patient outcome improvements

    • Comparison with alternative biomarkers

Research has demonstrated the exceptional diagnostic performance of KLRG2 methylation markers, which achieved an AUC of 0.934 in distinguishing pancreatic cancer from chronic pancreatitis . This suggests strong potential for clinical implementation, particularly when combined with other molecular markers to create comprehensive diagnostic panels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.