Recombinant Mouse KiSS-1 receptor (Kiss1r)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Mouse KiSS-1 Receptor

The Mouse KISS-1 Receptor (Kiss1r) functions as a receptor for metastin (kisspeptin-52 or kp-52), a C-terminally amidated peptide derived from the KiSS1 gene . This receptor is also known by several synonyms including G-protein coupled receptor 54, G-protein coupled receptor OT7T175, Kisspeptins receptor, Metastin receptor, mOT7T175, and Gpr54 . Originally identified following the discovery of kisspeptin from human melanoma cell lines in 1996, the critical importance of Kiss1r for reproduction was established in 2003 through seminal studies revealing that humans with KISS1R mutations failed to undergo puberty and exhibited infertility .

Kiss1r serves as the master regulator within the hypothalamic-pituitary-gonadal axis, playing an essential role in normal gonadotropin-releasing hormone physiology and puberty onset . The hypothalamic KiSS1/KISS1R system functions as a pivotal factor in central regulation of the gonadotropic axis during both development and adulthood . Consequently, both humans and mice with loss-of-function mutations in Kiss1r genes are infertile due to hypogonadotropic hypogonadism .

Recombinant Kiss1r for Research Applications

Recombinant Mouse KiSS-1 receptor refers to the artificially produced form of this protein used primarily for research applications. The development of recombinant Kiss1r has enabled the creation of specialized research tools such as the Mouse KISS-1 Receptor ELISA Kit, which offers high sensitivity and specificity for measuring KISS1R levels in mouse serum, plasma, and cell culture supernatants . This kit provides reliable quantification capabilities with a detection range of 1.56-100ng/mL and sensitivity of 0.784ng/mL .

The following table summarizes the technical specifications of a commercially available Mouse Kiss1r ELISA Kit:

ParameterSpecification
TargetMouse KiSS-1 receptor (Kiss1r)
SynonymsG-protein coupled receptor 54, G-protein coupled receptor OT7T175, Kisspeptins receptor, Metastin receptor, mOT7T175, KiSS-1R, Gpr54
Assay TypeSandwich
Detection MethodELISA
ReactivityMouse
Detection Range1.56-100ng/mL
Sensitivity0.784ng/mL
Molecular Weight40-140 kDa

Novel Signaling Mechanisms

Beyond traditional G protein signaling, a groundbreaking discovery reveals that KISS1R also signals independently of Gαq/11 via the β-arrestin pathway . This pathway triggers luteinizing hormone (LH) secretion, serving as a surrogate marker for GnRH secretion . Studies utilizing mice lacking either β-arrestin-1 or β-arrestin-2 demonstrated significantly diminished kisspeptin-dependent LH secretion compared to wild-type mice, confirming that β-arrestin mediates kisspeptin-induced GnRH secretion .

Both the Gαq/11-coupled pathway and the β-arrestin pathway mediate ERK1/2 activation, which is necessary for GnRH secretion . This dual signaling capability represents an important aspect of Kiss1r function, potentially allowing for sophisticated regulation of reproductive hormone secretion under varying physiological conditions.

Physiological Functions Beyond Reproduction

While Kiss1r's role in reproductive function is well-established, emerging research has identified additional physiological functions for this receptor.

Neurological Functions and Anxiety Regulation

Kiss1r signaling appears to impact neurological functions, particularly those related to anxiety. Studies using Kiss1r knockout models demonstrate altered anxiety-related behaviors in these animals . In elevated plus maze (EPM) tests, intact KISS1R-knockout rescue mice spent twice as much time in the open arms compared to controls, suggesting reduced anxiety levels . This indicates that KISS1R signaling may have anxiogenic effects.

Interestingly, Kiss1 mRNA expression has been detected not only in hypothalamic regions but also in the cerebral cortex, medial nucleus of amygdala, and anterodorsal preoptic nucleus . These expression patterns suggest broader neurological functions beyond reproductive control.

Tumor Metastasis Suppression

Kiss1r activation inhibits cell proliferation and cell migration, key characteristics of tumor metastasis . The KiSS1 protein itself is recognized as a metastasis suppressor, and its interaction with Kiss1r appears to mediate these anti-metastatic effects . This relationship suggests potential applications in cancer research and therapy development.

Research Models and Methodologies

Sophisticated research models have been developed to investigate Kiss1r functions in vivo.

Transgenic Mouse Models

Several transgenic mouse models have significantly advanced our understanding of Kiss1r:

  1. Global Kiss1r-null mice, which lack Kiss1r throughout the body and exhibit infertility

  2. Conditional Kiss1r-null mice with selective rescue of Kiss1r signaling in GnRH neurons

  3. Kiss1-Cre transgenic mice that express Cre recombinase specifically within kisspeptin-expressing cells

These models allow researchers to study different populations of kisspeptin cells and their interactions with Kiss1r-expressing neurons. For example, the J2-4 line exhibits Cre activity specifically within Kiss1 neurons, as verified through Cre-dependent expression of green fluorescent protein or β-galactosidase . These transgenic models were created using bacterial artificial chromosomes (BACs) containing the entire coding region of the Kiss1 gene with appropriate upstream and downstream sequences .

Therapeutic Potential and Future Directions

The critical role of Kiss1r in reproductive physiology and other biological functions positions it as a promising target for therapeutic interventions. The high-resolution structural data now available provides a solid foundation for structure-based drug design targeting Kiss1r .

Potential applications include:

  1. Treatments for reproductive disorders associated with dysregulated GnRH secretion

  2. Novel approaches for hormone-dependent cancers

  3. Interventions for anxiety-related disorders, considering Kiss1r's anxiogenic effects

  4. Anti-metastatic therapies leveraging Kiss1r's role in suppressing cell migration and proliferation

The detailed understanding of both the Gq/11 and β-arrestin signaling pathways may enable the development of biased ligands that selectively activate specific downstream pathways, potentially reducing side effects while maintaining therapeutic efficacy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
Kiss1r; Gpr54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; mOT7T175; Kisspeptins receptor; Metastin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MATEATLAPNVTWWAPSNASGCPGCGVNASDDPGSAPRPLDAWLVPLFFATLMLLGLVGN SLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA AYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRPHTSAHSDRAATH TVPHSRAAHPVRIRSPEPGNPVVRSPCAQSERTASL
Uniprot No.

Target Background

Function
KiSS-1 receptor (Kiss1r) is a receptor for metastin (kisspeptin-52 or kp-52), a C-terminally amidated peptide derived from KiSS1, a metastasis suppressor protein. Activation of Kiss1r inhibits cell proliferation and migration, crucial aspects of tumor metastasis. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system plays a pivotal role in the central regulation of the gonadotropic axis during puberty and adulthood. Analysis of the signaling pathways activated by Kiss1r reveals coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References Into Functions
  1. G-protein coupled receptor 54 (GPR54) deficiency leads to exacerbated experimental autoimmune encephalomyelitis (EAE) disease severity, independent of the reproductive axis. This deficiency results in impaired immunotolerance, associated with a reduced number of regulatory T-lymphocytes, increased T-cell activation, and altered thymocyte subsets. PMID: 29931449
  2. While uterine growth was fully restored by estrogen (E2) treatment of Kiss1(-/-) mice and by genetic restoration of kisspeptin signaling in GnRH neurons in Kiss1r(-/-) mice, functional adenogenesis was only partially restored. This indicates that, while uterine growth largely depends on ovarian E2 output via central kisspeptin signaling, peripheral kisspeptin signaling is crucial for endometrial adenogenesis and function. PMID: 27364226
  3. A study observed unaltered hypothalamic metabolic gene expression in Kiss1 receptor knockout mice despite obesity and reduced energy expenditure. PMID: 27601011
  4. Nesfatin-1 increased Kiss1R expression in hypothalamic cells. PMID: 28339602
  5. Kisspeptin-10 may contribute to accelerated progression and instability of atheromatous plaques, leading to plaque rupture. GPR54 antagonists may be beneficial for the prevention and treatment of atherosclerosis. PMID: 28411243
  6. Data suggests the utility of KISS1R as a novel biomarker for multiple myeloma, capable of targeting both tumor cells and host cells within the tumor microenvironment. PMID: 27158817
  7. Kiss1 and kiss1r mRNA levels were significantly elevated in old compared to reproductive-aged mice. Diet-induced obesity did not alter kiss1 or kiss1r mRNA levels. Compared to young control mice, young MCP-1 knockout mice exhibited significantly lower ovarian kiss1 mRNA. PMID: 26879207
  8. On day 4 of pregnancy, the mouse uterus expresses a functional kisspeptin/KISS1R signaling system. PMID: 26384646
  9. Gnaq was selectively inactivated in GnRH neurons of global Gna11--null mice, but they still responded to kisspeptin, confirming that KISS1R signals via non-Galphaq/11-coupled pathways. PMID: 26377475
  10. An orchestrated onset of kisspeptin and GPR54 expression in the male embryonic brain at embryonic day 13.5. PMID: 26172029
  11. Results demonstrate defective negative feedback in global Gpr54-null mice that cannot be attributed to a lack of prior exposure of the gonadotropin-releasing hormone neuronal network to cyclical estradiol. PMID: 25301053
  12. Expression of Kiss1 and Gpr54 was confirmed in mouse placenta, but no differences in birth weight were observed in mice supported by a mutant placenta during fetal development. PMID: 25468546
  13. The Kiss1/GPR54 system is involved in promoting uterine decidualization during early pregnancy in mice. PMID: 24830702
  14. Kiss1r in GnRH neurons is crucial for reproductive development and fertility. PMID: 24422632
  15. Kisspeptin-1 and Kiss1r signaling influences body weight, energy expenditure, and glucose homeostasis in a sexually dimorphic and partially sex steroid-independent manner. PMID: 24937427
  16. The kisspeptin receptor (Kiss1r), a GPCR activated by kisspeptin to regulate the onset of puberty and adult reproductive function, is enriched in cilia projecting from mouse. PMID: 24982149
  17. Oocytes fail to respond to gonadotropins with increased trk-B tyrosine kinase (Ntrk)2 expression in the absence of KISS1R. PMID: 24877631
  18. Failure of follicular development and ovulation linked to the absence of Kiss1r cannot be fully rescued by even extended gonadotropin replacement. PMID: 24885574
  19. Most GnRH neurons in the embryonic arcuate nucleus express kisspeptin receptor GPR54 upon circuit formation. PMID: 24599473
  20. The GnRH neuron is the key site of kisspeptin-Gpr54 signaling for fertility. PMID: 24051579
  21. Kisspeptin regulates gonadotropin gene expression through the activation of Kiss1R signaling via protein kinase C, inducing immediate early genes in vitro. PMID: 23770611
  22. Gonadal steroids are essential for the induction of kisspeptin expression in the rostral periventricular area of the third ventricle during pubertal development in the male mouse. PMID: 22340076
  23. It was concluded that elevated testosterone secretion in prenatal and neonatal mice is independent of both kisspeptin and GnRH signaling, and the necessity of kisspeptin-Kiss1r signaling for testicular function is first apparent after day 5. PMID: 22202164
  24. Data suggest a possible mechanism whereby GPR54 expression levels, and thus GnRH sensitivity to kisspeptin, may change dramatically over the pro-estrous day. PMID: 21756268
  25. Kiss1r attenuation was sufficient to delay breast tumor initiation, progression, and metastasis through inhibitory effects on the downstream Galphaq-p63RhoGEF-RhoA signaling pathway. PMID: 21852382
  26. Loss of GPR54 and kisspeptin are not fully equivalent in the mouse hypothalamus. PMID: 21527035
  27. Data show that female mice lacking neurons that express the kisspeptin receptor GPR54 were fertile. PMID: 21516099
  28. Gpr54-/- mice exhibit more pronounced defects in spermatogenesis than Kiss1-/- mice and improved spermatogenesis with age when exposed to dietary phytoestrogens. PMID: 21156837
  29. GPR54 regulates ERK1/2 activity and hypothalamic gene expression in a Galpha(q/11) and beta-arrestin-dependent manner. PMID: 20886089
  30. Gpr54 regulates Bmp7 expression through NFAT2 and Sp1 and plays a crucial role in embryonic kidney branching morphogenesis and glomerular development. PMID: 20375015
  31. Transcription factor SP1 binds directly to the mGPR54 promoter region and activates gene expression. PMID: 20152817
  32. Kiss1(-/-) and Gpr54(-/-) mice retain a degree of gonadotropin-releasing hormone activity, which is sufficient to influence vaginal cytology and uterine weights in female mice and on spermatogenesis and testicular weights in male mice. PMID: 19840236
  33. A complex temporal and spatial pattern of Gpr54 gene expression in developing GnRH neurons. PMID: 19966188
  34. Mutations in GPR54 cause autosomal recessive idiopathic hypogonadotropic hypogonadism in humans and mice, suggesting that this receptor is essential for normal gonadotropin-releasing hormone physiology and for puberty. PMID: 14573733
  35. The analysis of GPR54 mutant mice revealed developmental abnormalities of both male and female genitalia and histopathological changes in tissues that normally contain sexually dimorphic features. PMID: 14652023
  36. The localization and GnRH release effects of kisspeptin thus define GPR54 as a major control point in the reproductive axis and suggest kisspeptin to be a neurohormonal effector. PMID: 15665093
  37. Kisspeptin exerts a potent depolarizing effect on the excitability of almost all adult gonadotropin-releasing hormone (GnRH) neurons. Responsiveness of GnRH neurons to kisspeptin increases over postnatal development. PMID: 16339030
  38. Leptin infusion of ob/ob mice evoked a significant increase in KiSS-1 and GPR54 mRNA levels. PMID: 17595226
  39. Both Kiss1 and Gpr54 knockout mice have abnormal sexual maturation consistent with hypogonadotropic hypogonadism, although Kiss1 knockout mice appear to be less severely affected than their receptor counterparts. PMID: 17595229
  40. GnRH receptor/GnRH and GPR54/kisspeptin autoregulatory systems are integrated by negative feedback to regulate GnRH and kisspeptin secretion from GnRH neurons. PMID: 17698953
  41. GPR54 is necessary for proper male-like development of several sexually dimorphic traits, likely by regulating GnRH-mediated androgen secretion during critical periods in perinatal development. PMID: 17699664
  42. Kisspeptin-10 can significantly stimulate gonadotropin-releasing hormone (GnRH) release and GnRH mRNA expression in neurosecretory GT1-7 cells. PMID: 17728535
  43. In mice, kisspeptin-GPR54 signaling is required for the tonic stimulation of GnRH/LH secretion but is not required for generating the E-induced GnRH/LH surge. PMID: 17978050
  44. A potent stimulating effect of Kisspeptin at GnRH nerve terminals in the mediobasal hypothalamus of the mouse. PMID: 18450966
  45. Kisspeptin activates G protein-coupled receptor 54 (GPR54) to initiate a PLC-IP3R-calcium cascade that modulates ion channels to initiate depolarization in GnRH neurons. PMID: 18483150

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest level in the heart and 15- and 17-day embryos. Low level in other tissues. Colocalized with gonadotropin-releasing hormone (GnRH) neurons in the hypothalamus.

Q&A

What is the Kiss1/Kiss1r system and what is its primary physiological role?

The Kiss1/Kiss1r system consists of kisspeptin (encoded by the Kiss1 gene) and its receptor KISS1R (encoded by the Kiss1r gene). This system serves as an essential regulator of reproductive function in mammals. Loss-of-function mutations in either Kiss1 or Kiss1r genes in both humans and mice result in hypogonadotropic hypogonadism, characterized by abnormal sexual maturation and decreased circulating levels of sex steroids and gonadotropins .

The primary physiological role of the Kiss1/Kiss1r system appears to be the regulation of gonadotropin-releasing hormone (GnRH) secretion. Administration of kisspeptins induces a rapid increase in luteinizing hormone (LH) secretion through direct action on GnRH neurons . Additionally, the Kiss1/Kiss1r system is critical for sexual maturation, as both Kiss1r and Kiss1 expression increases during puberty, and administration of kisspeptin to juvenile rodents can precipitate puberty onset .

Where is Kiss1r expressed in mouse tissues?

Kiss1r shows a diverse expression pattern across multiple mouse tissues:

  • Central Nervous System: Kiss1r is expressed in the hypothalamus, particularly in GnRH neurons .

  • Reproductive Tissues: Western blot analysis using specific anti-KISS1R antibodies has demonstrated KISS1R expression in the testes and epididymis .

  • Seminiferous Tubules: Immunohistochemical studies reveal that KISS1R is present in the seminiferous tubules from postnatal week 3 to week 12, with clear localization on the cell membrane of round spermatids at 1000× magnification .

  • Bone Marrow: KISS1R is upregulated on mesenchymal stem cells (MSCs) and osteoprogenitor cells (OPCs) when co-cultured with myeloma cells .

Interestingly, KISS1R expression patterns may vary by species, life stage, and pathological status .

How does Kiss1r signaling function at the cellular level?

Kiss1r is a G-protein-coupled receptor that, when activated by kisspeptin, initiates several signaling cascades. In testicular development, luteinizing hormone (LH) appears to act as an upstream initiator to induce Kiss1 expression in mouse Leydig cells through the cAMP/PKA pathway .

The temporal relationship between Kiss1r signaling and other developmental factors is notable. Research shows that the expression levels of Insl3, Cyp19a1, and Kiss1 genes increase simultaneously after increased expression of the LH receptor gene (Lhcgr) . This synchronized expression pattern suggests that Kiss1r signaling works in concert with other developmental regulators.

In neuronal populations, Kiss1r activation in GnRH neurons leads to increased electrical activity and hormone release. The electrophysiological responses of GnRH neurons to kisspeptin increase across puberty, indicating developmental regulation of this signaling pathway .

What phenotypes are observed in Kiss1r knockout mouse models?

Kiss1r knockout mice exhibit several distinct phenotypes:

  • Reproductive Development: These mice are infertile due to hypogonadotropic hypogonadism .

  • Sexual Maturation: They show abnormal sexual maturation with impaired development of secondary sexual characteristics .

  • Hormone Levels: Decreased circulating levels of sex steroids and gonadotropins are observed .

  • Puberty: They fail to undergo normal pubertal development and remain in a prepubertal state .

These phenotypes closely mirror those observed in humans with loss-of-function mutations in KISS1R, highlighting the evolutionary conservation of this system's reproductive functions.

What are the optimal methods for generating recombinant mouse Kiss1r for in vitro studies?

For generating recombinant mouse Kiss1r protein for in vitro studies, researchers should consider:

Expression System Selection:

  • Mammalian expression systems (e.g., HEK293 or CHO cells) are preferred for producing functional Kiss1r with proper post-translational modifications.

  • Baculovirus expression systems can also yield high quantities of functional receptor protein.

Vector Design Considerations:

  • Include an N-terminal signal sequence to ensure proper membrane targeting.

  • Consider adding epitope tags (e.g., FLAG, His, or HA) for easy detection and purification, but verify tag positioning doesn't interfere with ligand binding.

  • For functional studies, fluorescent protein fusions (GFP/RFP) can be employed to track receptor localization.

Purification Strategy:

  • For membrane proteins like Kiss1r, detergent solubilization followed by affinity chromatography is typically employed.

  • Consider using stabilizing agents during purification to maintain receptor conformation.

Functional Validation:

  • Confirm ligand binding using radiolabeled or fluorescently-labeled kisspeptin.

  • Verify downstream signaling activation through cAMP/PKA pathway assessment .

How can one effectively visualize Kiss1r-expressing cells in mouse tissue samples?

Based on published methodologies, effective visualization of Kiss1r-expressing cells can be achieved through:

Immunohistochemistry (IHC):

  • Generate specific anti-KISS1R antibodies. For example, one study successfully produced an anti-KISS1R immunoglobulin Y antibody for KISS1R identification .

  • Verify antibody specificity through Western blot analysis against tissues known to express Kiss1r (hypothalamus, testis) versus negative controls.

  • Use appropriate dilution ratios (e.g., 1:800,000 as reported in one study) to achieve specific signal while minimizing background .

  • Include tissue-specific positive controls, such as hypothalamus for KISS1R detection.

  • Implement adsorption tests by preincubating antibodies with immunogenic peptides to confirm specificity .

Transgenic Reporter Systems:

  • Utilize Kiss1-Cre transgenic mice crossed with reporter mice expressing Cre-dependent fluorescent proteins or β-galactosidase .

  • This approach allows visualization of cells that express or have expressed Kiss1r during development.

Fluorescent Ligand Binding:

  • Conjugate kisspeptin with fluorescent dyes for both in vitro and in vivo visualization.

  • This approach has successfully demonstrated binding to Kiss1r-expressing cells in multiple myeloma models .

What are the challenges in characterizing Kiss1r-ligand interactions in vivo?

Characterizing Kiss1r-ligand interactions in vivo presents several methodological challenges:

Receptor Dynamics and Trafficking:

  • Kiss1r undergoes internalization upon ligand binding, complicating real-time tracking of receptor-ligand interactions.

  • Developing methods to distinguish between membrane-bound and internalized receptors is essential.

Tissue-Specific Expression Patterns:

  • Kiss1r expression varies across tissues and developmental stages, requiring careful experimental design.

  • The receptor shows inconsistent localization patterns between studies, with some reporting expression in spermatid acrosomes and others on spermatid membranes .

Ligand Stability and Bioavailability:

  • Kisspeptin has a short half-life in circulation, limiting exposure time for interaction studies.

  • Consider using kisspeptin analogs with enhanced stability for in vivo studies.

Downstream Signaling Verification:

  • Validation that observed ligand binding activates physiologically relevant signaling pathways is essential.

  • The cAMP/PKA pathway appears to be particularly important for Kiss1r signaling in testicular cells .

How can Kiss1r be used as a biomarker in disease models such as multiple myeloma?

Kiss1r shows promise as a biomarker in disease models, particularly multiple myeloma:

Dual Targeting Capability:

  • Kiss1r is upregulated on both myeloma cells and cells of the tumor microenvironment (mesenchymal stem cells and osteoprogenitor cells) .

  • This dual expression pattern makes it particularly valuable as it can target both the malignant cells and the surrounding microenvironment.

In Vivo Imaging Applications:

  • Fluorescently-labeled kisspeptin has been used successfully for in vivo imaging of myeloma bone lesions.

  • Studies show increased peak fluorescence in tumor-burdened limbs compared to contralateral controls after injection of conjugated kisspeptin .

Methodological Approach:

  • Generate fluorescently-labeled kisspeptin conjugates (e.g., with near-infrared fluorophores for in vivo applications).

  • Validate binding specificity in vitro using cell lines with confirmed Kiss1r expression.

  • For in vivo studies, inject conjugated kisspeptin into disease model mice.

  • Compare signal intensity between affected and unaffected tissues.

  • Confirm specificity through competition with unlabeled kisspeptin.

This approach offers potential for both diagnostic applications and for monitoring disease progression or treatment response in preclinical models.

What are the best transgenic mouse models available for studying Kiss1r function?

Several transgenic mouse models have been developed to study Kiss1r function:

Kiss1-Cre Transgenic Models:

  • These models express Cre recombinase under the control of the Kiss1 promoter.

  • Line J2-4 has been reported to show Cre activity specifically within Kiss1 neurons .

  • When crossed with reporter mice, they allow visualization of Kiss1-expressing cells through Cre-dependent expression of green fluorescent protein (GFP) or β-galactosidase (βGal) .

Reporter Lines for Kiss1r Visualization:

  • Reporter mice with Cre-dependent expression systems can be used to mark the location of Kiss1 neurons.

  • These models facilitate studies of Kiss1 neuron development, connectivity, and function .

Conditional Knockout Models:

  • Floxed Kiss1r alleles combined with tissue-specific Cre expression allow selective deletion of Kiss1r in specific cell types.

  • These models are valuable for dissecting cell-autonomous versus non-cell-autonomous functions of Kiss1r.

Point Mutation Models:

  • Models with specific mutations in Kiss1r that affect ligand binding or signaling can help elucidate structure-function relationships.

  • These are particularly useful for studying the consequences of human disease-associated mutations.

How can one quantify changes in Kiss1r expression in response to hormonal stimulation?

Quantifying changes in Kiss1r expression following hormonal stimulation requires reliable methodologies:

Quantitative Real-Time PCR (qRT-PCR):

  • Extract total RNA from tissues of interest using standard protocols.

  • Perform reverse transcription to generate cDNA.

  • Design primers specific to Kiss1r mRNA.

  • Include appropriate housekeeping genes (e.g., Rpl19 has been used successfully) for normalization .

  • Express results as fold changes compared to baseline or control conditions.

  • This approach has successfully demonstrated that Kiss1r mRNA is constitutively expressed in mouse testes from week 0 to 12 .

Western Blot Analysis:

  • Extract protein samples from tissues using appropriate buffers.

  • Separate proteins by SDS-PAGE and transfer to membranes.

  • Probe with validated anti-KISS1R antibodies.

  • KISS1R typically presents as a band at 43 kDa .

  • Include positive controls (e.g., hypothalamus) and negative controls.

  • Perform densitometric analysis to quantify changes.

Cell Culture Models for Direct Hormone Effects:

  • Primary mouse Leydig cells treated with LH and MA-10 cells treated with Br-cAMP have shown increased Kiss1 mRNA expression .

  • Cotreatment with protein kinase A inhibitor RP-cAMP significantly suppressed Br-cAMP-induced Kiss1 expression, confirming pathway specificity .

What methods are most effective for studying Kiss1r signaling in specific neuronal populations?

For studying Kiss1r signaling in specific neuronal populations, several sophisticated methods are available:

Electrophysiological Approaches:

  • Patch-clamp recording can measure direct neuronal responses to kisspeptin stimulation.

  • This approach has revealed that GnRH neurons show increased electrophysiological responses to kisspeptin across puberty .

Calcium Imaging:

  • Load neurons with calcium-sensitive dyes or express genetically-encoded calcium indicators.

  • Monitor changes in intracellular calcium in response to kisspeptin stimulation.

  • This approach can be used in acute brain slices or primary neuronal cultures.

Single-Cell Transcriptomics:

  • Isolate specific neuronal populations using fluorescence-activated cell sorting (FACS) or laser capture microdissection.

  • Perform single-cell RNA sequencing to identify co-expressed genes and signaling pathways.

  • This approach can reveal heterogeneity within Kiss1r-expressing neuronal populations.

Chemogenetic and Optogenetic Approaches:

  • Express designer receptors exclusively activated by designer drugs (DREADDs) or light-sensitive channels in Kiss1r-expressing neurons.

  • Selectively activate or inhibit these neurons to assess downstream effects on GnRH secretion and reproductive function.

How can one assess the functional consequences of Kiss1r mutations?

Assessing the functional consequences of Kiss1r mutations requires a multi-level approach:

In Vitro Receptor Function Assays:

  • Express wild-type and mutant Kiss1r in heterologous cell systems.

  • Measure ligand binding using labeled kisspeptin.

  • Assess downstream signaling activation (cAMP, calcium mobilization, ERK phosphorylation).

  • Quantify receptor internalization and trafficking.

  • Determine EC50 values to measure potency changes.

Knock-in Mouse Models:

  • Generate mice carrying specific Kiss1r mutations using CRISPR/Cas9 technology.

  • Assess reproductive phenotypes:

    • Puberty onset timing

    • Fertility

    • Gonadal development

    • Hormone levels (LH, FSH, sex steroids)

  • Evaluate hypothalamic-pituitary-gonadal axis function through hormone challenge tests.

Ex Vivo Tissue Function:

  • Prepare hypothalamic slices from mutant mice.

  • Measure electrophysiological responses of GnRH neurons to kisspeptin.

  • Assess GnRH release from hypothalamic explants.

In Vivo Rescue Experiments:

  • Test whether administration of GnRH can rescue reproductive defects in Kiss1r mutant mice.

  • This approach can distinguish between defects in GnRH neuron function versus peripheral reproductive tissues.

How should researchers address contradictory findings regarding Kiss1r localization in different tissues?

When confronting contradictory findings regarding Kiss1r localization, researchers should systematically address these discrepancies:

Methodological Differences Assessment:

  • Compare antibody sources, specificity validation methods, and detection techniques.

  • Evaluate fixation protocols, as different methods can affect epitope accessibility.

  • Consider the sensitivity of detection methods used (e.g., chromogenic IHC versus immunofluorescence).

Tissue-Specific Expression Patterns:

  • One study noted that KISS1R localization patterns were inconsistent with previous data, which indicated KISS1R on the acrosome rather than the membrane of spermatids .

  • Expression patterns may differ based on developmental stage, as shown by the constitutive expression of Kiss1r mRNA in mouse testes from birth to postnatal week 12, while Kiss1 expression begins at week 4 .

Validation Through Multiple Approaches:

  • Combine protein detection (IHC, Western blot) with mRNA localization (in situ hybridization).

  • Use transgenic reporter systems as independent confirmation.

  • Perform functional assays to confirm the physiological relevance of localization findings.

  • Consider single-cell resolution techniques to resolve heterogeneous expression within tissues.

Control Experiments:

  • Include appropriate positive controls (e.g., hypothalamus for KISS1R) .

  • Perform adsorption tests by preincubating antibodies with immunogenic peptides at varying concentrations .

  • Include knockout tissues when available to confirm antibody specificity.

What control experiments are essential when studying Kiss1r function in reproductive biology?

Essential control experiments for studying Kiss1r function include:

Antibody Validation Controls:

  • Dilution series to determine optimal antibody concentration (e.g., 1:800,000 dilution ratio) .

  • Preincubation with immunogenic peptides at varying concentrations (e.g., 10μM versus 100μM) .

  • Negative controls using tissues without primary antibodies .

  • Positive controls using tissues with known expression (e.g., hypothalamus for KISS1R) .

Signaling Pathway Verification:

  • Pharmacological inhibitor controls to confirm pathway specificity.

  • For example, using protein kinase A inhibitor RP-cAMP to suppress Br-cAMP-induced Kiss1 expression confirms the cAMP/PKA pathway involvement .

Developmental Controls:

  • Age-matched controls are critical when studying developmental processes.

  • Time-course studies from postnatal day 0 through adulthood to capture developmental changes in expression patterns .

Hormone Administration Controls:

  • Vehicle controls for hormone treatments.

  • Dose-response relationships to establish physiological relevance.

  • Time-course experiments to distinguish between acute and chronic effects.

Genetic Model Controls:

  • Heterozygous littermates as controls for homozygous knockout models.

  • Cre-negative littermates as controls for conditional knockout models.

  • Wild-type controls matched for genetic background, age, and sex.

How can researchers distinguish direct versus indirect effects of Kiss1r signaling?

Distinguishing direct from indirect effects of Kiss1r signaling requires strategic experimental approaches:

Cell-Specific Knockout Models:

  • Generate conditional knockout mice in which Kiss1r is deleted only in specific cell types of interest.

  • Compare phenotypes with global knockout to identify cell-autonomous effects.

Ex Vivo Systems:

  • Isolate specific cell types or tissues and stimulate with kisspeptin in the absence of other tissues.

  • This approach can reveal direct responsive cell types.

  • For example, treating isolated primary mouse Leydig cells with LH demonstrated direct regulation of Kiss1 expression .

Temporal Analysis:

  • Use rapid time-course experiments to identify immediate versus delayed responses.

  • Direct effects typically occur within minutes to hours, while indirect effects may take longer.

Pathway Inhibition:

  • Selectively block downstream signaling pathways to identify which are essential for specific outcomes.

  • The cAMP/PKA pathway has been identified as important for Kiss1 expression in Leydig cells .

Combined Approach Example:

  • Administer kisspeptin to wild-type mice and measure rapid LH increase.

  • Repeat in mice with Kiss1r specifically deleted in GnRH neurons.

  • Loss of LH response in the conditional knockout confirms direct action on GnRH neurons.

  • Persistence of other phenotypes would suggest additional direct targets.

What are the key considerations when comparing Kiss1r function across different mouse strains?

When comparing Kiss1r function across mouse strains, researchers should consider several factors:

Genetic Background Effects:

  • Different mouse strains can show varying baseline reproductive parameters.

  • Backcross experimental animals to a consistent genetic background when possible.

  • If using mixed backgrounds, ensure appropriate controls from each parental strain.

Developmental Timing Variations:

  • Strains differ in puberty onset timing and reproductive development milestones.

  • Document strain-specific developmental timelines as baseline data.

  • Age-match precisely when comparing across strains.

Hormone Level Differences:

  • Baseline hormone levels (LH, FSH, sex steroids) vary between strains.

  • Measure strain-specific reference ranges before interpreting experimental results.

Expression Pattern Comparison:

  • Quantify Kiss1r expression levels across tissues of interest in each strain.

  • Use identical methodologies and reagents when comparing strains.

  • Both mRNA (qRT-PCR) and protein (Western blot, IHC) quantification may be necessary.

Functional Response Variations:

  • Dose-response relationships to kisspeptin may differ between strains.

  • Establish strain-specific dose-response curves before comparative studies.

  • Consider both sensitivity (EC50) and maximal response parameters.

Data Normalization Strategy:

  • When comparing across strains, normalize data to strain-specific controls rather than absolute values.

  • Consider using percent change from baseline rather than raw values.

  • For developmental studies, align data based on developmental milestones rather than chronological age.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.