Recombinant Mouse Kit ligand (Kitlg)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant Kitlg is produced using diverse platforms:

  • E. coli: Yields tag-free or His-tagged protein with partial sequences (e.g., 26–189 aa) .

  • Baculovirus-Insect Cells: Generates full-length protein (Met1-Ala189) with post-translational modifications .

  • Hordeum vulgare (barley): Used for His-tagged variants with high solubility .

Biological Functions and Signaling Pathways

Kitlg regulates multiple physiological processes through c-Kit receptor activation:

Table 2: Key Signaling Pathways and Outcomes

PathwayFunctional RoleReferences
PI3K/AKTPromotes cell survival and proliferation
MAPK/ERKMediates differentiation and migration
JAK/STATSupports hematopoietic stem cell maintenance
PLCγ/DAG-IP3Regulates calcium signaling and mast cell function

In Vitro Assays

  • Cell Proliferation: Kitlg stimulates TF-1 erythroleukemic cells (EC₅₀: 0.5–5 ng/mL) .

  • Receptor Binding: Binds c-Kit with high affinity (linear range: 1.28–32 ng/mL in ELISA) .

In Vivo Models

  • Retinal Protection: Overexpression of Kitlg via AAV8 vectors reduces light-induced photoreceptor degeneration in mice .

  • Hematopoiesis: Restores bone marrow stem cell populations in Kit mutant models .

Table 3: Stability Under Different Conditions

ConditionStabilitySources
Lyophilized12 months at -80°C
Reconstituted6 months at -80°C with 0.1% HSA/BSA

Research Findings and Therapeutic Potential

  • Neuroprotection: Kitlg upregulates Hmox1 via NRF2, mitigating oxidative stress in photoreceptors .

  • Synergistic Effects: Enhances interleukin-driven hematopoiesis and mast cell development .

Future Directions

  • Gene Therapy: AAV-delivered Kitlg shows promise for treating retinitis pigmentosa .

  • Cancer Research: Dual role in tumorigenesis (pro-survival vs. differentiation) warrants mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments default to blue ice packs. If dry ice shipping is required, please communicate your request in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Kitlg; Kitl; Mgf; Sl; Slf; Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; c-Kit ligand
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-273
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Uniprot No.

Target Background

Function
Kit ligand (KITLG/SCF) serves as a ligand for the receptor-type protein-tyrosine kinase KIT. It plays a critical role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and melanogenesis. The binding of KITLG/SCF can activate several signaling pathways. It promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leading to the activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals through GRB2, activating RAS, RAF1, and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Additionally, KITLG/SCF and KIT contribute to the activation of STAT family members STAT1, STAT3, and STAT5. They also promote activation of PLCG1, resulting in the production of diacylglycerol and inositol 1,4,5-trisphosphate, important cellular signaling molecules. KITLG/SCF exhibits synergistic activity with other cytokines, likely interleukins.
Gene References Into Functions
  1. These findings suggest that SCF, in addition to its pro-proliferative effects, plays a significant role in mast cell differentiation. PMID: 27619074
  2. In vitro studies demonstrate that SCF induces phosphorylation of p38 MAPK and cofilin, leading to the migration of cardiac stem cells. PMID: 28986094
  3. MAPK3/1 is involved in primordial follicle activation through mTORC1-KITL signaling. PMID: 28218391
  4. MicroRNA-205 maintains T cell development following stress by regulating Foxn1 and its two regulated targets, stem cell factor and ccl25, following stress. PMID: 27646003
  5. Bone marrow adipocytes synthesize SCF, promoting hematopoietic stem cell proliferation and regeneration. PMID: 28714970
  6. SCF/c-kit signaling may potentiate chronic hypoxia-induced vascular remodeling by modulating ERK activation. Inhibition of c-kit activity could potentially alleviate PH. PMID: 26705118
  7. Kit ligand regulates the subcellular localization of FOXO3 in the neonatal mouse ovary. PMID: 26507072
  8. Research suggests that c-kit/KITL signaling also occurs in the human ovary, as established in various animal models, and may involve previously unknown autocrine signaling. PMID: 26008799
  9. Streptozotocin-induced diabetes was induced in cKit-mutant mice with low cKit expression in their endothelial cells. PMID: 26978025
  10. This study suggests that extracellular HMGB1 participates in NLRP3 inflammasome activity and regulates IL-1beta associated sterile inflammation induced by MWCNT. PMID: 25779020
  11. These findings indicate that mast cell deficiency, in the absence of Kit mutations, does not play a role in regulating weight gain or insulin resistance. PMID: 25955205
  12. Stem cell factor is essential for preserving the reconstitution capacity of ex vivo expanded cord blood CD34(+) cells in immunocompromised mice. PMID: 25899394
  13. High stem cell factor expression is associated with breast cancer metastasis. PMID: 23577751
  14. Cardiomyocyte-specific overexpression of hSCF promotes epicardial activation and myocardial arteriogenesis post MI. PMID: 25107671
  15. SCF+G-CSF treatment in chronic stroke remodels neural circuits in the aged brain. PMID: 23750212
  16. Data indicate that SCF disrupts the endothelial adherens junction and enhances vascular leakage, suggesting that anti-SCF/cKit therapy may hold promise as a potential treatment for hyperpermeable vascular diseases. PMID: 24790137
  17. Results show that the c-kit/mSCF/MMP-9 axis regulates IL-23 gene expression in DCs to control IL-17 production in the lung. PMID: 24829419
  18. Data suggest that insulin-like growth factor-1 (IGF1) stimulates s tem cell factor (Kitl/KITLG) protein and mRNA expression and promoter activity by activating several signaling pathways. PMID: 24116170
  19. Wnt7a triggers melanocyte stem cell differentiation through beta-catenin activation, and Kitl might induce the subsequent migration of melanoblasts to the epidermis. PMID: 23702581
  20. Data and the identification of c-kit/Kit-ligand clusters at cell contacts suggest that membrane-bound Kit ligand captures cell surface-expressed c-kit. PMID: 22637532
  21. SCF plays a major role in the homeostatic control of mast cell activation, with potential relevance to mast cell-driven disease and the development of novel approaches for the treatment of allergic disorders. PMID: 22529299
  22. Proliferation and the basal/luminal cell composition of cells isolated from the proximal region of prostatic ducts (the stem cell niche) are regulated in part by opposing effects of stem cell factor and endogenous TGF-beta. PMID: 22024978
  23. Data show the tumor-promoting potential of mast cells could be augmented by molecules released from damaged tumor cells through cooperative stimulation of stem cell factor (SCF) and ligand for Toll-like receptor 4 (TLR4). PMID: 21877248
  24. Membrane-bound Steel factor controls germ cell motility within a "motility niche" that moves through the embryo with the germ cells. PMID: 21998739
  25. These experiments revealed a new function of stem cell factor in chemokine receptor coupling. PMID: 20427772
  26. The altered sorting of KitL is dispensable for hematopoietic and melanogenic lineages, yet is crucial in the testicular environment, where the basal membranes of adjacent polarized Sertoli cells form a niche for the proliferating spermatogonia. PMID: 19874813
  27. Results suggest that the c2j tyrosinase defect can be rescued in part by stem cell factor in the ears and tail. PMID: 19682281
  28. Diabetic mice show a decline in the number of interstitial cells of Cajal and impairment in their ultrastructures, and these abnormalities are attributed to a deficiency in endogenous SCF but are not related to hyperglycemia. PMID: 19875700
  29. The cell surface form of SCF primarily promotes the proliferation of hemopoietic stem cells. PMID: 11811778
  30. Data demonstrate that Kitl induces telomerase activity in mitotic spermatogonia and increases the mRNA levels of both the catalytic subunit form and the telomerase RNA template. PMID: 11950883
  31. The intracellular signaling pathway of SCF/KIT-mediated cell migration. PMID: 11964302
  32. The roles of fibronectin and stem cell factor in melanocyte growth, differentiation, and migration. PMID: 12028583
  33. The involvement of Kit/SCF at different stages of spermatogenesis. PMID: 12080001
  34. SCF is involved in the induction of LTP, and the blockade of LTP by rmSCF might be due to an occlusion of SCF/c-kit signaling. PMID: 12137920
  35. Different isoforms of SCF may utilize different biochemical pathways in stimulating survival and/or proliferation of erythroid cells. PMID: 12149209
  36. Stem cell factor radioprotection is attributed to PLC gamma 1-dependent negative regulation of ionizing radiation-induced neutral sphingomyelinase stimulation. PMID: 12149210
  37. Stem cell factor (kit ligand) stimulates neurogenesis in vitro and in vivo. PMID: 12163450
  38. Identification of an allelic series of mutations in the kit ligand gene. PMID: 12242244
  39. Effects of ethylnitrosourea-induced Kitl point mutations on survival and peripheral blood cells of Kitl(Steel) mice. PMID: 12242245
  40. SCF is a potent eosinophil degranulator and activator, potentially playing numerous roles during an inflammatory/immune response. PMID: 12453875
  41. Levels of E2A protein expression in B cell precursors are stage-dependent and inhibited by stem cell factor, primarily through posttranscriptional regulation. PMID: 12482503
  42. Data suggest that FoxO3 plays a crucial role in kit ligand-mediated survival of hematopoietic progenitors. PMID: 12691919
  43. Phosphatidylinositol 3-kinase is essential for kit ligand-mediated survival. PMID: 12960281
  44. Stem cell factor plays a significant role in restoring hepatocyte proliferation in IL-6 knockout mice following hepatectomy. PMID: 14597766
  45. While transmembrane-SCF does not appear to play a role in the homing of transplanted cells to the bone marrow, it is critical in the lodgment and detainment of HSC within their hemopoietic "niche." PMID: 14662336
  46. SLF and SDF-1alpha have a synergistic effect in fetal hematopoietic stem cells. PMID: 15024423
  47. XPA (-/-), SCF-Tg mice did not develop skin cancers after repeated exposures to UVB for 30 wk at a total dose of 72 J per cm(2). PMID: 15191564
  48. C-terminal valine defines a specific endoplasmic reticulum export signal in Kitl. PMID: 15475566
  49. Cessation of SCF treatment results in the rapid reduction of cutaneous skin mast cell populations by apoptosis. PMID: 15502858
  50. SCF plays a role in cell migration and survival in the developing cortex. SCF is a survival factor, but not a mitogen or a differentiation factor for neural stem cells. PMID: 15530856

Show More

Hide All

Database Links
Protein Families
SCF family
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.
Tissue Specificity
Expressed in the cochlea.

Q&A

What are the different forms of Kit Ligand and how do they function differently?

Kit Ligand exists in two primary forms: membrane-bound Kit Ligand (mKITL) and soluble Kit Ligand (sKITL). The membrane-bound form requires direct cell-cell contact between KIT receptor-expressing cells (like hematopoietic stem cells) and the cells expressing mKITL (such as endothelial cells). The soluble form is produced through cleavage of the membrane-bound form by metalloproteases and can act systemically .

Recent research has revealed that while both forms are important, they may have distinct biological roles. Studies using conditional deletion of specific forms show that endothelial deletion of the membrane-bound form reduces systemic levels of soluble KIT ligand without affecting stem cell numbers, suggesting the HSC regulatory role is primarily mediated by soluble rather than membrane KIT ligand expression in endothelial cells .

What is the molecular structure and basic properties of recombinant mouse Kit Ligand?

Recombinant Mouse Kit Ligand is typically produced as a single, non-glycosylated polypeptide chain in E. coli expression systems. The protein:

  • Contains 164 amino acids with a molecular mass of approximately 18-19 kDa

  • The first five N-terminal amino acids are Met-Lys-Glu-Ile-Cys

  • The recombinant form typically comprises amino acids Lys26-Ala189, with an N-terminal Met

  • Appears as a single band at 19 kDa on SDS-PAGE under reducing conditions

What are the optimal storage conditions for maintaining recombinant mouse Kit Ligand stability?

Proper storage of recombinant mouse Kit Ligand is critical for maintaining its biological activity. Based on manufacturer recommendations, the optimal storage conditions are:

DurationTemperatureCondition
12 months-20°C to -70°CAs supplied (lyophilized)
1 month2°C to 8°CUnder sterile conditions after reconstitution
3 months-20°C to -70°CUnder sterile conditions after reconstitution

It's essential to use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity . When working with the protein, aliquoting the reconstituted solution into single-use volumes can help minimize degradation from multiple freeze-thaw events.

What reconstitution protocols should be followed for optimal activity?

For optimal activity, reconstitution protocols depend on whether you're using carrier-free formulations or those containing BSA (Bovine Serum Albumin). The recommended protocols include:

  • For preparations with BSA: Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin

  • For carrier-free preparations: Reconstitute at 100 μg/mL in sterile PBS

  • Alternative recommendation: Reconstitute the lyophilized Kit Ligand in sterile 18MΩ-cm H₂O at a concentration not less than 100 μg/ml, which can then be further diluted to other aqueous solutions

The reconstituted protein should appear as a clear solution. Any particulates or cloudiness might indicate protein denaturation.

How should I design cell proliferation assays using recombinant mouse Kit Ligand?

When designing cell proliferation assays with recombinant mouse Kit Ligand, consider the following methodological approach:

  • Cell line selection: The TF-1 human erythroleukemic cell line is widely used to assess Kit Ligand activity

  • Dose range determination: The effective dose (ED₅₀) for stimulating TF-1 cell proliferation typically ranges from 2.5-10 ng/mL, corresponding to a specific activity of approximately 1×10⁵ IU/mg

  • Control conditions: Include both negative controls (no Kit Ligand) and positive controls (known concentration of active Kit Ligand)

  • Incubation period: Optimal incubation times are typically 48-72 hours at 37°C with 5% CO₂

  • Measurement method: Standard proliferation assays such as MTT, XTT, or direct cell counting can be used to quantify the response

  • Data analysis: Generate a dose-response curve to determine the ED₅₀ value for your specific experimental conditions

This approach allows accurate assessment of Kit Ligand's biological activity while ensuring experimental reproducibility.

What methods can be used to measure soluble Kit Ligand levels in biological samples?

For measuring soluble Kit Ligand levels in biological samples such as serum or bone marrow fluid, enzyme-linked immunosorbent assay (ELISA) is the preferred method. The following protocol has been validated in research settings:

  • Sample collection and processing:

    • For serum: Allow blood samples to clot for 2 hours, then centrifuge for 20 minutes at 2000g

    • For bone marrow extracellular fluid: Remove distal epiphysis from mouse femur, centrifuge for 1 minute at 3000g to collect bone marrow fluid into PBS buffer, mix by pipetting, and centrifuge for 3 minutes at 300g to collect supernatant

  • ELISA procedure:

    • Use a commercial Kit Ligand ELISA kit (e.g., from R&D Systems)

    • Measure optical density at 450 nm with wavelength correction at 570 nm

    • Extrapolate concentration from a standard curve run within each experiment

  • Data interpretation:

    • Normal systemic levels of soluble Kit Ligand in mouse models can serve as reference values

    • Consider that Kit Ligand levels may vary between bone marrow microenvironment and systemic circulation

This methodology provides reliable quantification of soluble Kit Ligand in different biological compartments, enabling comparative analyses between experimental conditions.

How does Kit Ligand influence hematopoietic stem cell maintenance and what are the implications for experimental design?

Kit Ligand plays a critical role in hematopoietic stem cell (HSC) maintenance through complex mechanisms. Recent research findings have refined our understanding of this process:

  • Differential roles of Kit Ligand forms: While both membrane-bound and soluble forms of Kit Ligand are important, research suggests that the soluble form may play a more significant role in systemic HSC regulation than previously thought. When endothelial-specific deletion of membrane-bound Kit Ligand was performed, it reduced systemic levels of soluble Kit Ligand but did not affect HSC numbers, suggesting a primary regulatory role for the soluble form .

  • Niche-independent regulation: HSCs were unaffected in Kit Ligand-deleted bones implanted into mice with normal systemic levels of soluble Kit Ligand, supporting the importance of systemic rather than local niche expression .

  • Experimental implications:

    • When designing experiments to study HSC maintenance, researchers should consider both local and systemic Kit Ligand effects

    • Conditional knockout models targeting specific forms of Kit Ligand can help distinguish between local and systemic functions

    • The concentration and duration of recombinant Kit Ligand treatment should be carefully optimized based on the specific HSC population and experimental question

  • In vitro versus in vivo considerations: In vitro experiments may not fully recapitulate the complex interplay between different forms of Kit Ligand and their effects on HSCs, necessitating complementary in vivo approaches for comprehensive understanding.

What is the role of Kit Ligand in neuronal function and how can recombinant Kit Ligand be used in neuroscience research?

Recent research has revealed unexpected roles for Kit Ligand in neuronal function, particularly in the central nervous system:

  • Synaptic maintenance: The Kit Ligand/Kit receptor dyad is crucial for sustaining mammalian central synapse function. In the cerebellar cortex, Kit is enriched in molecular layer interneurons (MLIs), while Kit Ligand is selectively expressed by Purkinje cells (PCs) .

  • Inhibitory neurotransmission: Genetic manipulation of PC Kit Ligand and MLI Kit demonstrated that this ligand-receptor pair is required for, and capable of driving changes in, the inhibition of PCs. This suggests a role in regulating GABAergic inhibitory drive to Purkinje cells .

  • Neurodevelopmental implications: Inactivating Kit mutations have been implicated in neurodevelopmental disorders, including developmental delay, ataxia, hypotonia, intellectual disability, and autism spectrum disorders .

  • Research applications:

    • Recombinant Kit Ligand can be used to investigate synapse formation and maintenance in neuronal cultures

    • It may serve as a tool to modulate inhibitory neurotransmission in experimental models

    • The protein could be valuable for studying the role of Kit signaling in neurodevelopmental processes

  • Methodological considerations: When using recombinant Kit Ligand in neuroscience applications, researchers should consider:

    • Optimal concentrations may differ from those used in hematopoietic studies

    • The timing of application may be critical, especially in developmental studies

    • Combined electrophysiological and molecular approaches may be necessary to fully characterize effects on synaptic function

How can inconsistent results with recombinant Kit Ligand be addressed in experimental settings?

Inconsistent results when working with recombinant Kit Ligand can stem from multiple factors. Here are methodological approaches to troubleshoot and improve experimental reproducibility:

  • Protein quality assessment:

    • Verify protein integrity through SDS-PAGE analysis; properly functioning Kit Ligand should appear as a single band at approximately 19 kDa under reducing conditions

    • Confirm biological activity using a standardized TF-1 cell proliferation assay, with expected ED₅₀ values between 2.5-10 ng/mL

  • Storage and handling issues:

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Ensure appropriate reconstitution buffers are used (PBS with 0.1% albumin for standard preparations or PBS alone for carrier-free formulations)

    • Maintain cold chain during all handling steps

  • Experimental design factors:

    • Cell responsiveness may vary with passage number; establish consistent criteria for cell culture conditions

    • Serum components can interfere with Kit Ligand activity; consider using defined serum-free media for critical experiments

    • The presence of metalloproteinases in experimental systems may affect the stability of Kit Ligand

  • Quantification methods:

    • For ELISA-based detection, ensure antibodies recognize the recombinant form being used

    • Prepare standard curves with the same recombinant protein used in experiments

    • Include appropriate positive and negative controls in each experimental run

  • Data interpretation:

    • Account for the different biological responses mediated by membrane-bound versus soluble forms

    • Consider that systemic versus local effects may have distinct dose-response relationships

How do recent findings about membrane-bound versus soluble Kit Ligand challenge previous experimental paradigms?

Recent research has revealed nuanced aspects of Kit Ligand biology that challenge established experimental paradigms and necessitate refined approaches:

  • Revised understanding of form-specific functions: The traditional view that membrane-bound Kit Ligand is the primary regulator of HSC maintenance has been questioned by findings showing that endothelial deletion of membrane-bound Kit Ligand reduced systemic soluble Kit Ligand levels but had no effect on stem cell numbers .

  • Systemic versus local effects: The observation that HSCs were unaffected in Kit Ligand-deleted bones implanted into mice with normal systemic levels of soluble Kit Ligand suggests that systemic rather than local niche expression of soluble Kit Ligand may be more critical than previously thought .

  • Experimental design implications:

    • Single form-specific knockouts or knockdowns may yield unexpected results due to compensatory mechanisms or indirect effects on other forms

    • Experiments using recombinant Kit Ligand should consider the potential differences between exogenous administration and endogenous expression patterns

    • The timing and duration of Kit Ligand exposure may be critical variables affecting experimental outcomes

  • Methodological adjustments:

    • Include measurements of both membrane-bound and soluble forms when possible

    • Consider using conditional, cell type-specific deletion models to more precisely define the roles of different Kit Ligand forms

    • Complementary in vitro and in vivo approaches may be necessary to fully understand the complex biology

  • Integration of neuronal findings: The recent discovery of Kit Ligand's role in synaptic function suggests that its biology extends beyond the traditionally studied hematopoietic and developmental contexts, requiring broader experimental approaches that consider tissue-specific effects.

What are the most promising future research directions for Kit Ligand studies?

The evolving understanding of Kit Ligand biology points to several promising research directions that may yield significant insights:

  • Form-specific functions: Further exploration of the distinct roles of membrane-bound versus soluble Kit Ligand in different tissues and developmental contexts could resolve current contradictions in the literature .

  • Neuronal functions: The recently discovered role of Kit Ligand in synaptic maintenance and inhibitory neurotransmission opens new avenues for investigating its potential contributions to neurological and neurodevelopmental disorders.

  • Translational applications: The ability of Kit Ligand to regulate stem cell behavior suggests potential applications in regenerative medicine, particularly for hematopoietic disorders and tissue repair.

  • Signaling pathway interactions: Investigating how Kit Ligand signaling interacts with other critical pathways in development and homeostasis could reveal new regulatory mechanisms and therapeutic targets.

  • Refined experimental tools: Development of form-specific antibodies, more precise genetic models, and improved recombinant proteins would enable more definitive studies of Kit Ligand's diverse functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.