Recombinant Mouse L-gulonolactone oxidase (Gulo)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize requests for specified tags. Please communicate your tag requirements.
Synonyms
Gulo; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-440
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Gulo
Target Protein Sequence
VHGYKGVQFQNWAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGGV IGSGTHNTGIKHGILATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTVT LQCVPQFHLLETSFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSIIYQDHTNKEPSS ASNWFWDYAIGFYLLEFLLWTSTYLPRLVGWINRFFFWLLFNCKKESSNLSHKIFSYECR FKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEKMYPAFHKFCDIR EKLDPTGMFLNSYLEKVFY
Uniprot No.

Target Background

Function
Oxidizes L-gulono-1,4-lactone to hydrogen peroxide and L-xylo-hexulonolactone, which spontaneously isomerizes to L-ascorbate.
Gene References Into Functions
  • Severe vitamin C deficiency, characterized by decreased locomotor activity, reduced physical strength, and increased sucrose preference, is observed in gulo-deficient mice unable to synthesize ascorbic acid. PMID: 23106783
  • Ascorbate deficiency in Gulo knockout mice results in abnormal behavioral phenotypes. PMID: 22296218
  • Studies demonstrate a direct correlation between ascorbic acid levels and oxidative stress in Gulo(-/-) mice. PMID: 20599829
  • Research indicates that the sfx mutation causing spontaneous bone fractures in mice is due to a large deletion in the L-gulonolactone oxidase gene (chromosome 14). PMID: 15674730
  • The sfx mutation, affecting the GULO gene, leads to ascorbic acid deficiency, impaired osteoblast function, and fractures in affected mice. PMID: 16059632
  • Gulo-deficient mice exhibit normal cognitive function but are unable to synthesize ascorbic acid; brain and liver ascorbic acid levels are higher in Gulo-sufficient mice. PMID: 18466336
  • Gene therapy using HDAd-mCMV-Gulo vectors enables GULO expression and endogenous ascorbic acid production in human cells and Gulo(-/-) mice. PMID: 18764764
  • Findings suggest that beta-catenin regulates vitamin C biosynthesis in the liver via regucalcin and L-gulonolactone oxidase expression. PMID: 19690176
Database Links
Protein Families
Oxygen-dependent FAD-linked oxidoreductase family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in liver.

Q&A

What is L-gulonolactone oxidase and why is it significant for research?

L-gulonolactone oxidase (Gulo) is the enzyme catalyzing the terminal step in vitamin C biosynthesis, converting L-gulono-gamma-lactone to ascorbic acid. Its significance for research stems from its critical role in vitamin C metabolism and the evolutionary implications of its loss in certain species, including humans and other primates. Understanding Gulo function provides insights into vitamin C-dependent processes, evolutionary biology, and potential therapeutic strategies for addressing vitamin C deficiency. Recombinant mouse Gulo serves as an excellent model for such investigations due to its high expression and functional activity in experimental systems .

What are the molecular characteristics of the mouse Gulo gene and protein?

The mouse Gulo gene spans approximately 22 kb and contains 12 exons separated by 11 introns ranging in size from 479 to 5641 bp. The cDNA (2.3 kb) encodes an open reading frame of 440 amino acids that demonstrates over 94% homology to rat L-gulonolactone oxidase. The protein functions as an FAD-containing enzyme that catalyzes the conversion of L-gulono-gamma-lactone to ascorbic acid. Northern blot analysis has revealed high expression of the Gulo transcript predominantly in the liver, consistent with the liver being the primary site of vitamin C synthesis in most mammals .

What are the key considerations when designing experiments with recombinant mouse Gulo?

When designing experiments with recombinant mouse L-gulonolactone oxidase, researchers should carefully consider several factors. First, define clear research questions and hypotheses related to Gulo function, expression, or role in vitamin C metabolism. Second, identify appropriate independent variables (e.g., Gulo concentration, substrate levels, reaction conditions) and dependent variables (e.g., enzyme activity, vitamin C production, downstream metabolic effects). Third, control for extraneous variables such as buffer conditions, temperature, pH, and the presence of cofactors like FAD that might affect enzyme activity. Fourth, incorporate appropriate controls, including negative controls (reactions without enzyme) and positive controls (reactions with known active enzyme). Finally, ensure that the experimental design allows for statistical validation of results through proper randomization and replication .

How should researchers approach the expression and purification of recombinant mouse Gulo?

Expressing functional recombinant mouse L-gulonolactone oxidase requires careful consideration of the expression system. Early studies revealed that overexpression of Gulo may be inhibitory to cell growth, necessitating controlled expression strategies. A successful approach involves using adenoviral vectors with removable stuffer fragments flanked by lox sites between the promoter and the Gulo gene, allowing for regulated expression in appropriate cell lines. For purification, standard protein purification techniques can be employed, but care must be taken to preserve the association with the FAD cofactor essential for enzymatic activity. Researchers should validate the functionality of purified recombinant Gulo by testing its ability to convert L-gulono-gamma-lactone to ascorbic acid in cell-free extracts. This functional validation is critical before proceeding with downstream applications or analyses .

What controls are essential when working with recombinant mouse Gulo?

Essential controls when working with recombinant mouse L-gulonolactone oxidase include:

  • Activity controls: Testing enzyme activity with known substrates and comparing kinetic parameters to established values.

  • Specificity controls: Verifying that the enzyme acts specifically on L-gulono-gamma-lactone and not on other similar compounds.

  • Cofactor dependency: Confirming FAD requirement by testing activity with and without added FAD.

  • Species comparison controls: Including rat or other mammalian Gulo enzymes when making comparative analyses.

  • Negative controls: Using enzyme preparations from humans or other primates that naturally lack functional Gulo.

  • Vector controls: When using expression systems, including empty vector controls to distinguish effects of Gulo from effects of the expression system itself.

  • Time course analyses: Monitoring enzyme activity over time to establish linearity and determine optimal reaction conditions .

What methods are recommended for analyzing the functional activity of recombinant mouse Gulo?

For analyzing the functional activity of recombinant mouse L-gulonolactone oxidase, several methodological approaches are recommended:

  • Spectrophotometric assays: Monitoring the reduction of cytochrome c or other electron acceptors during the oxidation of L-gulono-gamma-lactone.

  • HPLC analysis: Quantifying the conversion of L-gulono-gamma-lactone to ascorbic acid.

  • Oxygen consumption: Measuring oxygen uptake during the enzymatic reaction using oxygen electrodes.

  • Cell-based assays: Assessing vitamin C production in cells expressing recombinant Gulo.

  • Enzyme kinetics: Determining Km and Vmax values for L-gulono-gamma-lactone and comparing with literature values.

When interpreting results, researchers should consider factors such as the purity of the enzyme preparation (≥85% by SDS-PAGE), the requirement for the FAD cofactor, and the potential inhibitory effects of reaction products. Standardization against known enzyme concentrations and activities is essential for reliable and reproducible results .

How can researchers address the challenges of Gulo overexpression toxicity in cellular systems?

Overexpression of L-gulonolactone oxidase has been observed to potentially inhibit cell growth, presenting a significant challenge for researchers. To address this issue, several strategies can be employed:

  • Inducible expression systems: Utilize tetracycline-inducible or similar systems to control the timing and level of Gulo expression.

  • Cre-lox systems: Implement the approach demonstrated in previous research where a removable stuffer fragment flanked by lox sites is placed between the promoter and the Gulo gene, allowing for controlled expression only in the presence of Cre recombinase.

  • Dosage titration: Carefully titrate the amount of expression vector used to achieve optimal Gulo expression without cytotoxicity.

  • Antioxidant supplementation: Since overproduction of vitamin C or its metabolites might cause oxidative stress, co-administration of complementary antioxidants may help mitigate toxicity.

  • Cell line selection: Test multiple cell lines to identify those more tolerant to Gulo expression.

Careful monitoring of cell viability, growth rates, and redox status is essential when implementing these strategies to ensure experimental validity while minimizing confounding effects from cellular stress responses .

What are the expected parameters for recombinant mouse Gulo activity in vitro?

When analyzing recombinant mouse L-gulonolactone oxidase activity in vitro, researchers should expect the following parameters:

ParameterExpected RangeNotes
Molecular Weight~50-55 kDaSDS-PAGE analysis
Optimal pH7.0-7.5Activity is pH-dependent
Optimal Temperature37°CPhysiological temperature
Km for L-gulono-gamma-lactone0.1-1.0 mMMay vary with reaction conditions
FAD RequirementEssentialActivity depends on FAD association
Purity Requirement≥85%As determined by SDS-PAGE
Detection Range (ELISA)31.2-2000 pg/mLFor quantification in biological samples
Sensitivity (ELISA)<14.4 pg/mLLower limit of detection

These parameters provide a framework for validating the quality and activity of recombinant enzyme preparations. Deviations from these expected values may indicate issues with protein folding, cofactor association, or the presence of inhibitors in the reaction mixture .

How should researchers interpret contradictory data when studying recombinant mouse Gulo?

When encountering contradictory data in recombinant mouse L-gulonolactone oxidase research, researchers should implement a systematic approach to resolution:

  • Examine experimental variables: Review all experimental conditions, including buffer composition, pH, temperature, cofactor availability, and enzyme concentration, as these can significantly impact enzyme activity.

  • Assess enzyme quality: Verify enzyme purity and integrity through SDS-PAGE, western blotting, and activity assays to ensure the contradictions are not due to protein degradation or heterogeneity.

  • Consider post-translational modifications: Different expression systems may produce Gulo with varying post-translational modifications that affect activity.

  • Review methodological differences: Compare the methodological approaches used in contradictory studies, paying particular attention to how activity was measured.

  • Design critical experiments: Design targeted experiments specifically to address the contradictions, including appropriate controls.

  • Implement statistical validation: Apply rigorous statistical analysis to determine if the contradictions are statistically significant or within expected experimental variation.

This approach allows researchers to systematically identify sources of contradiction and develop a more comprehensive understanding of Gulo function and regulation .

What statistical approaches are most appropriate for analyzing Gulo activity data?

When analyzing L-gulonolactone oxidase activity data, researchers should consider the following statistical approaches:

  • Descriptive statistics: Calculate means, standard deviations, and coefficients of variation to characterize the central tendency and variability of enzyme activity measurements.

  • Hypothesis testing: Use t-tests for comparing two conditions (e.g., with vs. without cofactor) or ANOVA for multiple conditions (e.g., different pH levels or substrate concentrations).

  • Regression analysis: Apply linear or non-linear regression for enzyme kinetics data to determine parameters such as Km and Vmax.

  • Statistical control charts: Implement these for monitoring consistency in enzyme activity across different preparations or over time.

  • Power analysis: Conduct prior to experiments to determine appropriate sample sizes needed to detect biologically meaningful differences in enzyme activity.

  • Non-parametric tests: Consider these when data do not meet assumptions of normality or when working with small sample sizes.

For all statistical analyses, researchers should clearly report the specific tests used, p-values, confidence intervals, and effect sizes to enable proper interpretation and reproducibility of results. Statistical significance should always be interpreted in the context of biological significance .

What are the common challenges in expressing functional recombinant mouse Gulo?

Researchers working with recombinant mouse L-gulonolactone oxidase frequently encounter several challenges:

  • Growth inhibition: Overexpression of Gulo has been observed to inhibit cell growth, complicating the production of high yields of recombinant protein. This effect was noted during the construction of adenoviral vectors expressing Gulo, where low rescue efficiency and reduced viral growth in HEK293 cells were observed.

  • Cofactor incorporation: Ensuring proper incorporation of the FAD cofactor essential for catalytic activity can be challenging in some expression systems.

  • Protein folding: Achieving correct folding of the 440-amino acid protein, particularly in prokaryotic expression systems, may be difficult.

  • Solubility issues: Recombinant Gulo may form inclusion bodies or aggregate during expression or purification.

  • Functional verification: Confirming that the recombinant enzyme possesses catalytic activity comparable to the native enzyme requires carefully designed functional assays.

To address these challenges, researchers have developed strategies such as using controlled expression systems with removable stuffer fragments flanked by lox sites between the promoter and the Gulo gene, allowing for regulated expression only when needed. This approach has been shown to result in efficient vector rescue, normal viral replication, and high-level expression of functional Gulo in appropriate cell lines .

How can researchers optimize experimental conditions for studying Gulo-mediated vitamin C synthesis?

Optimizing experimental conditions for studying L-gulonolactone oxidase-mediated vitamin C synthesis requires attention to several key factors:

  • Substrate concentration: Titrate L-gulono-gamma-lactone concentrations to determine optimal levels for enzyme activity without substrate inhibition.

  • Cofactor availability: Ensure sufficient FAD is present in the reaction mixture, as this is essential for Gulo activity.

  • pH optimization: Test a range of pH values (typically 6.5-8.0) to identify conditions for maximal enzyme activity.

  • Temperature control: Maintain consistent temperature (typically 37°C) during reactions to ensure reproducible activity measurements.

  • Buffer composition: Optimize buffer components, including ionic strength and the presence of stabilizing agents.

  • Oxygen availability: Since the reaction involves oxidation, ensure adequate oxygen is available in the reaction system.

  • Product inhibition management: Implement strategies to prevent inhibition by accumulated ascorbic acid, such as continuous product removal or time-course analysis.

Each of these parameters should be systematically varied while holding others constant to determine optimal conditions. Once established, these optimized conditions should be rigorously maintained across experiments to ensure reproducibility .

What strategies can address the low detection sensitivity of Gulo in certain experimental systems?

When confronting challenges with low detection sensitivity of L-gulonolactone oxidase in experimental systems, researchers can implement several strategies:

  • Enzyme-linked immunosorbent assay (ELISA): Utilize specialized ELISA kits with detection ranges as low as 31.2-2000 pg/mL and sensitivity below 14.4 pg/mL for mouse Gulo.

  • Amplification systems: Employ enzyme-coupled assay systems that amplify the signal generated by Gulo activity.

  • Fluorogenic substrates: Develop or use fluorogenic substrates that produce highly detectable signals upon Gulo-mediated conversion.

  • Enrichment techniques: Implement affinity purification or concentration steps prior to analysis to increase the local concentration of the enzyme.

  • RT-qPCR: For detecting expression at the mRNA level, quantitative PCR can provide high sensitivity when protein-level detection is challenging.

  • Western blotting optimization: Enhance detection limits through optimized antibodies, signal amplification systems, and sensitive chemiluminescent or fluorescent detection methods.

  • Mass spectrometry: Apply targeted proteomics approaches for highly sensitive and specific detection of Gulo peptides in complex mixtures.

These approaches can be used individually or in combination depending on the specific experimental context and the nature of the samples being analyzed .

What are the potential applications of recombinant mouse Gulo in gene therapy research?

Recombinant mouse L-gulonolactone oxidase offers promising applications in gene therapy research, particularly for addressing vitamin C deficiency in humans and other species lacking functional Gulo. Studies have already demonstrated the feasibility of functional rescue of vitamin C synthesis in human cells using adenoviral vectors expressing mouse Gulo cDNA. Future gene therapy approaches could target specific tissues or systems where vitamin C plays crucial roles, such as the immune system, brain, or tissues under oxidative stress. Research could focus on developing optimized delivery systems, tissue-specific promoters for controlled expression, and safety evaluations of long-term Gulo expression in primate systems. Additionally, investigating the metabolic consequences of restored vitamin C synthesis versus dietary supplementation could provide insights into the differential effects of endogenous versus exogenous vitamin C, potentially revealing new therapeutic approaches for vitamin C-dependent disorders .

How might recombinant mouse Gulo contribute to understanding evolutionary aspects of vitamin C metabolism?

Recombinant mouse L-gulonolactone oxidase provides a valuable tool for investigating the evolutionary implications of vitamin C synthesis loss in primates, including humans. By comparing the functional properties of mouse Gulo with reconstructed ancestral primate Gulo sequences, researchers can gain insights into the molecular evolution of this enzyme and the selective pressures that led to its inactivation. This research could help answer questions about why the ability to synthesize vitamin C was lost multiple times independently across different animal lineages and whether this loss provided any evolutionary advantages. Additionally, introducing functional Gulo into human or primate cell models can help elucidate how metabolic pathways have adapted to compensate for the loss of endogenous vitamin C synthesis over the 40+ million years since the inactivating mutation occurred. These insights could contribute to our broader understanding of evolutionary medicine and the metabolic consequences of gene loss events .

What novel analytical approaches could advance research on recombinant mouse Gulo?

Advancing research on recombinant mouse L-gulonolactone oxidase could benefit from several novel analytical approaches:

  • Cryo-electron microscopy: Determine high-resolution structures of Gulo to better understand its catalytic mechanism and substrate interactions.

  • Single-molecule enzymology: Study the kinetic behavior of individual Gulo molecules to uncover heterogeneity in catalytic activity.

  • Metabolomics integration: Combine Gulo activity assays with comprehensive metabolomic profiling to understand the broader metabolic impact of vitamin C synthesis.

  • CRISPR-Cas9 genome editing: Create precise modifications to the Gulo gene to study structure-function relationships in vivo.

  • Systems biology modeling: Develop computational models of vitamin C metabolism incorporating Gulo activity to predict system-level effects of enzyme modulation.

  • Protein engineering: Apply directed evolution or rational design approaches to create Gulo variants with enhanced stability or activity.

  • Multi-omics approaches: Integrate transcriptomics, proteomics, and metabolomics data to comprehensively assess the impact of Gulo expression on cellular physiology.

These advanced approaches could provide deeper insights into Gulo function, regulation, and its role in vitamin C metabolism, potentially leading to novel therapeutic strategies for addressing vitamin C deficiency or related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.