Recombinant Mouse L-selectin (Sell)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Mouse L-selectin (SELL/CD62L) is a glycosylated transmembrane protein belonging to the selectin family. It mediates:

  • Leukocyte rolling on vascular endothelium during inflammation

  • Lymphocyte homing to secondary lymphoid organs via high endothelial venules (HEVs)

  • Signal transduction through cytoplasmic tail interactions with ERM proteins and calmodulin

3.1. Immune Cell Trafficking Studies

  • Enhances CD8<sup>+</sup> T-cell recruitment to virus-infected tissues (e.g., influenza, vaccinia) .

  • Knockout models show 50% reduction in activated T-cell homing to lungs .

3.2. Cancer Metastasis

  • Facilitates lymph node metastasis in transgenic mouse insulinoma models .

  • Anti-L-selectin antibodies block tumor cell adhesion to HEVs .

3.3. Signaling Pathways

  • Clustering induces p38 MAPK activation and chemokine receptor upregulation (e.g., CCR7) .

  • ADAM17-mediated shedding reduces T-cell adhesion but enhances cytotoxic degranulation .

Key Research Findings

  1. Viral Immunity:

    • L-selectin<sup>hi</sup> CD8<sup>+</sup> T cells clear influenza 2× faster than L-selectin<sup>low</sup> cells .

    • Soluble L-selectin inversely correlates with CD107a<sup>+</sup> cytotoxic activity in tumor microenvironments .

  2. Proteolytic Regulation:

    • ADAM17-independent shedding observed in naive T cells .

    • Non-cleavable mutants increase T-cell retention in lymph nodes by 8-fold .

  3. Therapeutic Targeting:

    • Blocking L-selectin reduces neutrophil recruitment by 80% in inflammation models .

    • Soluble L-selectin isoforms are elevated in rheumatic diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will then fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sell; Lnhr; Ly-22; Ly22; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; Lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; CD antigen CD62L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-372
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKKGKKSQERMDDPY
Uniprot No.

Target Background

Function
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. It facilitates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. It also promotes the initial tethering and rolling of leukocytes in endothelia.
Gene References Into Functions
  1. Data suggests that Ly6C(+)CD62L(+) infected monocytes acted as a Trojan horse across the cerebral endothelium, leading to brain infection. Therefore, CD62L should be considered not only as a temporally elicited antigen but also as a disease-relevant leukocyte marker during the development of neurologic melioidosis. PMID: 27646437
  2. Myeloid-derived suppressor cell-induced L-selectin loss occurs through a contact-dependent, post-transcriptional mechanism that is independent of the major L-selectin sheddase, ADAM17. However, it results in a significant elevation of circulating L-selectin in tumor-bearing mice. PMID: 27929373
  3. CD8(+) T-cells mediate ischemia reperfusion injury in a fatty liver through L-selectin. PMID: 28543181
  4. L-selectin is transported constitutively by the AP-1 complex, leading to the formation of a trans-Golgi network reserve pool. Phosphorylation of the L-selectin tail blocks AP-1-dependent retrograde transport of L-selectin PMID: 28235798
  5. Freezing and thawing of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which has been established as a crucial factor contributing to the in vivo protective effects of Tregs PMID: 26693907
  6. Endothelial colony-forming cells interact with activated neutrophils via PSGL-1 and L-selectin PMID: 24606340
  7. These data indicate that L-selectin plays a significant role in the development of C protein induced polymyositis, while ICAM-1 plays a lesser role, if any. PMID: 24644046
  8. Data suggest that modulation of P- and L-selectins may offer a promising therapeutic approach. PMID: 24177139
  9. These results call into question the utility of CD62L as a predictive biomarker for the efficacy of ex vivo-expanded T cells after ACT in lymphopenic conditions. PMID: 24218360
  10. The PSGL-1-L-selectin complex-induced signaling effects on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway. PMID: 24127491
  11. L-selectin-dependent signalling - exploring the different signals that potentially arise from distinct phases of the multi-step adhesion cascade and the contribution of known binding partners of L-selectin in this respon PMID: 23299028
  12. CD62L marks a mature natural killer (NK) cell subset by affecting the magnitude of the local NK cell response to adenovirus infection in the liver. PMID: 23509354
  13. Data indicate that naive lung CD4 cells supply the draining lymph nodes through a CD62L-independent, CCR7-dependent pathway. PMID: 23319636
  14. Signaling induced by ligation of L-selectin using mAb or endothelial cell-expressed ligand significantly enhanced the chemotaxis of murine T cells and B cells to SLC but not to other homeostatic chemokines. PMID: 22387549
  15. Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart. PMID: 21869829
  16. Hematopoietic lineage cells with Sca-1(high) expression and CD62L(neg/low) expression are characterized as multipotent progenitor cells, based on transient engraftment. PMID: 21998453
  17. The binding of L-selectin to its vascular and extravascular ligands is differentially regulated by pH. PMID: 21982762
  18. CD4 T cell co-stimulation with ICOS promotes the down-regulation of CCR7 and CD62L after activation, leading to a reduced return of activated CD4 T cells to the lymph nodes and a more efficient entry into the lungs. PMID: 21421907
  19. Data show a mechanism of control of CD62-L expression involving the miRNA let-7b. PMID: 21768364
  20. Atherosclerotic plaques did not exhibit any differences in cellular composition assessed by immunohistochemistry for CD68, CD3, CD4, and CD8 in ApoE(-/-)L-sel(-/-) as compared to ApoE(-/-) mice. PMID: 21760899
  21. Migratory profile of CD62L-/- Tregs was that of an intermediate activated phenotype with higher expression of pro-inflammatory chemokine receptors compared to CD62LHi Tregs and much greater expression of CCR7 compared to CD62LLo Tregs. PMID: 21070606
  22. IL-7 drives Cdc25A-mediated T-cell proliferation, which prevents the nuclear translocation of Foxo1, leading to reduced expression of CD62L and the migration of T cells into circulation. PMID: 20831893
  23. In cultured cells and in mice, myeloid differentiation (MyD88)-dependent activation of B cells via Toll-like receptor TLR2 or TLR9 causes rapid loss of expression of CD62L by shedding caused by systemic infection with Salmonella typhimurium. PMID: 20660707
  24. Study suggests that L-selectin and ICAM-1 regulate Th2 and Th17 cell accumulation into the skin and lung, leading to the development of fibrosis. PMID: 20624949
  25. Division-linked differentiation predicts the differences in proportion of cells CD62L(high) observed between responses of different adoptive transfer number and within individual mice. PMID: 19859082
  26. Lymphoma cells are the major contributors to levels of soluble forms of L-selectins in lymphoma-bearing mice PMID: 20001233
  27. Auditory stress enhances contact hypersensitivity (CH) response, and the augmentation of this CH response might be mediated through L-selectin, but not through P- or E-selectin pathways. PMID: 19948832
  28. Our data indicate a critical role for CD62L and lymph node homing for the process of homeostatic proliferation PMID: 19658092
  29. The role of L-selectin in induction of alloantigen-specific tolerance PMID: 11823485
  30. Required for recruitment of dendritic cells to lymph nodes during mouse mammary tumor virus infection PMID: 11830477
  31. Surprisingly, L-selectin expressed on endogenous leukocytes also facilitates metastasis in both the syngeneic and xenogeneic (T and B lymphocyte deficient) systems PMID: 11854515
  32. CD62L expression is not essential for the development of T cell-mediated type 1 diabetes in NOD mice. PMID: 11884430
  33. L-selectin contributes to immune complex-induced skin injury cooperatively with ICAM-1 by regulating the accumulation of neutrophils and mast cells. PMID: 11884469
  34. L-selectin dimerization enhances tether formation to properly spaced ligand. PMID: 11907045
  35. Heparin's anti-inflammatory effects require glucosamine 6-O-sulfation and are mediated by blockade of L- and P-selectins. PMID: 12093896
  36. Influences lymphocyte migration in vivo, and increased levels present in certain pathologic conditions may adversely affect leukocyte migration PMID: 12165530
  37. CD62L expression is necessary for the diabetes-delaying effect of transfer of CD4+CD25+ splenocytes in vivo, but not for their suppressor function in vitro. PMID: 12193715
  38. Culture-activated T cells with the CD62 L-selectin(low) phenotype have potent antitumor activity and memory in vitro and in vivo. When adoptively transferred, they can eliminate advanced pulmonary metastases and cure subcutaneous tumors. PMID: 12218152
  39. L-selectin is involved in the P- and E-selectin-independent migration of cytotoxic T lymphocytes into inflamed skin. PMID: 12370362
  40. L-selectin regulates pulmonary fibrosis by mediating the accumulation of leukocytes. PMID: 12414509
  41. Loss of nasal passage and reproductive tract immunity in L-selectin-deficient mice at 16 days postprimary intranasal immunization with cholera toxin is due to delay of L-selectin(low)/alpha4beta7 integrin (double- low) B cells entering these sites. PMID: 12421944
  42. L-selectin cooperatively with ICAM-1 regulates induction of the immediate-type hypersensitivity response by mediating mast cell accumulation into inflammatory sites. PMID: 12682269
  43. L-selectin/PNAd, alpha4beta1 integrin/VCAM-1, and LFA-1, targets specific lymphocyte subsets to BALT. PMID: 12756264
  44. Leukocyte-expressed PSGL-1 serves as the main L-selectin ligand in inflamed postcapillary venules. PMID: 12756271
  45. Data suggest that Trousseau syndrome is likely triggered by interactions of circulating carcinoma mucins with leukocyte L-selectin and platelet P-selectin without requiring accompanying thrombin generation. PMID: 12975470
  46. L-selectin shedding from antigen-activated T cells prevents reentry into peripheral lymph nodes PMID: 14597735
  47. In a chronic ileitis model, pathogenic CD4+ T cells alternatively engage L-selectin to recirculate to the chronically inflamed small intestine. PMID: 15699171
  48. L-selectin plays a role in the growth of thymic lymphoma PMID: 15705798
  49. Leukocytes can continue to roll in the absence of optimal P-selectin/PSGL-1 interaction using an alternative mechanism involving P-selectin-, L-selectin-, and sLe(x)-bearing ligands PMID: 15743805
  50. Preferential migration of CD62L+CD4+ cells into the appendix as compared to the colon PMID: 15905618

Show More

Hide All

Database Links

KEGG: mmu:20343

STRING: 10090.ENSMUSP00000027871

UniGene: Mm.1461

Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Predominantly expressed in lymphoid tissue.

Q&A

What is Mouse L-selectin/SELL and what are its key functions?

Mouse L-selectin (SELL), also known as CD62L, is a crucial adhesion molecule belonging to the selectin family of proteins. It functions primarily in two major biological processes: regulating leukocyte migration at inflammation sites and controlling lymphocyte recirculation between blood and lymphoid tissues. L-selectin is uniquely expressed on leukocytes and consists of a large, highly glycosylated extracellular domain, a single transmembrane domain, and a small cytoplasmic tail. It serves as a "homing receptor" that enables leukocytes to enter secondary lymphoid tissues via high endothelial venules. This interaction occurs when ligands on endothelial cells bind to L-selectin-expressing leukocytes, which slows leukocyte trafficking through the blood and facilitates entry into secondary lymphoid organs. L-selectin-mediated lymphocyte recirculation is essential for maintaining appropriate tissue distribution of lymphocyte subpopulations, including naïve and effector subsets such as regulatory T cells.

What are the structural characteristics of recombinant Mouse L-selectin proteins?

Recombinant Mouse L-selectin proteins typically include the extracellular domain of the native protein, spanning from either Trp39 or Met1 to Asn332, depending on the specific product. These recombinant proteins are commonly expressed in HEK293 cells to ensure proper glycosylation and folding patterns that mimic the native protein. Various fusion tags are employed for purification and detection purposes, including C-terminal His tags and Fc chimeras. The calculated molecular weight of the core protein is approximately 61 kDa, but due to extensive glycosylation, the observed molecular weight typically ranges between 80-120 kDa when analyzed by SDS-PAGE. This significant difference between calculated and observed molecular weights is characteristic of heavily glycosylated proteins like L-selectin and is crucial for its biological function.

How do Mouse L-selectin splice variants differ functionally?

The mouse sell gene comprises 9 exons and generates two identified splice variants, L-selectin-v1 and L-selectin-v2. Both variants contain an additional exon located between exons 7 and 8 of the standard gene. These variants share the first 49bp sequence of this additional exon, but L-selectin-v2 extends with an extra 51bp immediately downstream. This results in longer cytoplasmic tails compared to the wild-type protein (WT = 17 amino acids; v1 = 30 amino acids; v2 = 32 amino acids). While these splice variants constitute only 2-3% of the total L-selectin mRNA in natural conditions, overexpression studies have revealed their unique functional properties. When overexpressed in cells lacking L-selectin, these variants exhibit altered capacities in adhesion to sLex under flow conditions, different patterns of ectodomain shedding in response to cellular activation, and varied signaling to p38 MAPK following antibody-mediated clustering.

What are the optimal reconstitution and storage conditions for lyophilized Recombinant Mouse L-selectin?

Lyophilized Recombinant Mouse L-selectin requires careful handling for optimal activity. For reconstitution, the protein should be dissolved in sterile PBS at a concentration of 0.1 mg/mL. The reconstitution process should be performed gently, avoiding vigorous shaking that could denature the protein. Storage conditions significantly impact protein stability and activity. The lyophilized form is generally stable for up to 12 months when stored at temperatures between -20°C and -80°C. Once reconstituted, the protein solution can be stored at 4-8°C for short-term use (2-7 days). For longer storage, aliquot the reconstituted protein into single-use volumes to avoid repeated freeze-thaw cycles, and store at temperatures below -20°C, where they remain stable for approximately 3 months. Using a manual defrost freezer is recommended to maintain stable temperature conditions. Protectants such as 5-8% trehalose or mannitol and 0.01% Tween 80 are typically added before lyophilization to enhance stability.

How can researchers validate the biological activity of Recombinant Mouse L-selectin?

The biological activity of Recombinant Mouse L-selectin can be validated through adhesion assays that measure its ability to bind target cells. One established method involves coating plates with the Recombinant Mouse L-selectin/CD62L Fc Chimera and measuring cell adhesion in a dose-dependent manner. Specifically, when 5 × 10^4 cells/well are added to the coated plates, adhesion can be observed after a 1-hour incubation at 37°C. The ED50 (effective dose for 50% response) for this adhesion effect typically ranges from 0.3 to 1.2 μg/mL. Researchers should optimize these conditions for their specific experimental systems, as cellular responses may vary based on cell types and experimental conditions. Alternative validation methods include flow cytometry to assess binding to known ligands, or functional assays that measure downstream signaling events such as p38 MAPK activation following L-selectin engagement.

What experimental approaches can be used to study L-selectin-mediated leukocyte trafficking in vivo?

Studying L-selectin-mediated leukocyte trafficking in vivo requires sophisticated experimental designs that track cell movement across different tissues. A multi-faceted approach typically includes:

  • Intravital microscopy: This technique allows real-time visualization of leukocyte rolling, adhesion, and extravasation in living animals. Fluorescently labeled leukocytes can be tracked as they interact with endothelial cells through L-selectin-mediated processes.

  • Adoptive transfer experiments: Leukocytes expressing different levels of L-selectin (wild-type, L-selectin-deficient, or non-cleavable L-selectin variants) can be adoptively transferred into recipient mice to track their migration patterns to different tissues.

  • Genetic models: Comparing trafficking in L-selectin knockout mice versus those expressing non-cleavable L-selectin variants can reveal the importance of L-selectin expression and shedding in leukocyte migration.

  • Bioassays with recombinant proteins: Recombinant Mouse L-selectin can be used to block endogenous interactions, helping to elucidate the specific role of L-selectin in complex trafficking patterns.

Research has shown that increasing L-selectin expression in cytotoxic CD8 T-cells facilitates viral clearance by enhancing trafficking to virus-infected organs. This finding emerged from studies showing that antigen-primed CD8 T-cells re-express L-selectin after egressing from lymph nodes, which proves essential for trafficking toward visceral or mucosal virus-infected sites.

How can Recombinant Mouse L-selectin be utilized in studies of chronic inflammation and autoimmune diseases?

Recombinant Mouse L-selectin serves as a valuable tool for investigating chronic inflammation and autoimmune diseases through multiple experimental approaches:

  • Blocking studies: The recombinant protein can be used to block endogenous L-selectin interactions, helping to determine the contribution of L-selectin to leukocyte recruitment in disease models. This approach can identify whether L-selectin is a viable therapeutic target for specific inflammatory conditions.

  • Adhesion assay development: Recombinant L-selectin can be used to develop standardized adhesion assays to screen potential anti-inflammatory compounds that might inhibit L-selectin-mediated leukocyte recruitment.

  • Comparative analyses with splice variants: Studies comparing the activity of wild-type L-selectin with its splice variants can reveal how alternative splicing may contribute to disease progression or resolution.

  • Structure-function relationship studies: Recombinant proteins with specific mutations can help identify critical domains for L-selectin function in inflammatory contexts.

L-selectin has been identified as a mediator of leukocyte recruitment during chronic inflammatory and autoimmune diseases, making it a potential therapeutic target for drug development. Experimental evidence suggests that modulating L-selectin expression or function could affect disease outcomes by altering leukocyte trafficking to sites of chronic inflammation.

What experimental considerations are important when studying L-selectin shedding in immune responses?

Studying L-selectin shedding requires careful experimental design to accurately capture this dynamic process:

  • Time-course experiments: L-selectin shedding occurs rapidly after cellular activation, so time-resolved measurements are essential. Flow cytometry with surface staining for L-selectin at multiple time points can track the kinetics of shedding.

  • Soluble L-selectin detection: ELISA assays to measure soluble L-selectin in culture supernatants or biological fluids should be performed alongside surface expression analysis to confirm active shedding rather than internalization.

  • Shedding inhibitor controls: Including metalloprotease inhibitors (e.g., TAPI-0) as controls helps distinguish between enzymatic shedding and other mechanisms of L-selectin loss.

  • Genetic approaches: Comparing wild-type L-selectin with non-cleavable mutants in functional assays can reveal the biological significance of shedding in specific immune responses.

Research has shown that L-selectin shedding dynamics significantly impact immune cell function. For instance, L-selectin shedding in tumor antigen-primed human CD8 TCM cells inversely correlates with the upregulation of the degranulation marker CD107a and enhanced tumor lytic activity. Making L-selectin non-cleavable through genetic modification can increase viral clearance in CD8 T-cells without obviously altering cytokine secretion profiles or clonal expansion.

How can researchers distinguish between the effects of membrane-bound and soluble forms of L-selectin?

Distinguishing between the effects of membrane-bound and soluble L-selectin requires specialized experimental approaches:

  • Selective blockade: Use antibodies that specifically recognize either membrane-bound or soluble L-selectin to selectively block each form.

  • Recombinant protein comparison: Compare the effects of recombinant soluble L-selectin (or the transmembrane-less human splice variant) with cell-based assays using membrane-anchored L-selectin.

  • Differential expression systems: Generate cells expressing either wild-type (sheddable) L-selectin, non-cleavable L-selectin mutants, or secreted L-selectin variants to isolate their specific contributions.

  • Concentration-dependent effects: Soluble L-selectin may exhibit concentration-dependent effects distinct from membrane-bound forms, requiring careful dose-response studies.

What factors affect the purity and activity of Recombinant Mouse L-selectin in experimental systems?

Several factors can influence the purity and activity of Recombinant Mouse L-selectin:

  • Expression system: HEK293 cells are commonly used for expression because they provide appropriate post-translational modifications, particularly glycosylation, which is critical for L-selectin function. The observed molecular weight (80-120 kDa) is significantly higher than the calculated weight (61 kDa) due to glycosylation, highlighting its importance.

  • Purification method: Affinity chromatography using the His or Fc tag is typically employed for purification. The purity should exceed 95% as determined by reducing SDS-PAGE to ensure reliable experimental results.

  • Endotoxin contamination: Endotoxin levels should be below 1.0 EU per μg of protein (determined by the LAL method) to avoid non-specific immune activation that could confound experimental results.

  • Storage and handling: Improper reconstitution, storage, or excessive freeze-thaw cycles can lead to protein degradation and loss of activity. Reconstituted protein should be stored at 4-8°C for short-term use (2-7 days) or aliquoted and frozen at -20°C for longer-term storage.

  • Buffer composition: The formulation buffer (typically 20mM PB, 150mM NaCl, pH 7.4) and presence of protectants (5-8% trehalose, mannitol, 0.01% Tween 80) can significantly affect protein stability and activity.

How can researchers optimize adhesion assays using Recombinant Mouse L-selectin?

Optimizing adhesion assays with Recombinant Mouse L-selectin requires attention to several experimental parameters:

  • Coating concentration: Titrate the coating concentration of Recombinant Mouse L-selectin to determine the optimal amount for consistent cell adhesion. Published data indicate that the ED50 for adhesion is typically between 0.3-1.2 μg/mL for L-selectin Fc chimera.

  • Cell density: The standard protocol uses 5 × 10^4 cells/well, but this may need adjustment based on the specific cell type and assay format.

  • Incubation conditions: Standard conditions include 1-hour incubation at 37°C, but temperature, time, and medium composition should be optimized for specific cell types.

  • Flow conditions vs. static conditions: L-selectin-mediated rolling adhesion is particularly important under flow conditions, so considering shear stress in the experimental design may be necessary for physiologically relevant results.

  • Positive and negative controls: Include appropriate controls such as wells coated with non-specific proteins (negative control) and wells coated with known adhesion molecules (positive control).

  • Detection method: Various detection methods can be used, including fluorescent labeling of cells, colorimetric assays, or label-free detection systems. The choice depends on the specific experimental requirements and available equipment.

What are the key considerations for comparing data across different Recombinant Mouse L-selectin preparations?

When comparing data across different Recombinant Mouse L-selectin preparations, researchers should consider:

  • Protein sequence variations: Different recombinant preparations may include different portions of the L-selectin sequence. For example, some preparations span Trp39-Asn332, while others may include Met1-Asn332. These differences can affect functional properties.

  • Fusion tag effects: The presence and type of fusion tags (His, Fc, etc.) can influence protein behavior. His-tagged and Fc-chimera versions may display different binding kinetics or multivalent effects.

  • Post-translational modifications: The expression system significantly impacts glycosylation patterns, which are critical for L-selectin function. Variations between different expression hosts or even different batches from the same host can introduce variability.

  • Purity considerations: Higher purity preparations (>95%) are generally more reliable for consistent results. Lower purity may introduce confounding factors.

  • Activity normalization: When possible, normalize activity data to a standard preparation or use activity units rather than protein concentration for more meaningful comparisons.

  • Standardized assay conditions: Use consistent experimental conditions across comparisons, including buffer composition, temperature, and incubation times.

Different commercial preparations of Recombinant Mouse L-selectin show variations in their molecular weights (ranging from 80-120 kDa), fusion tags, and specific sequence coverage, which can all affect experimental outcomes.

How do the mouse L-selectin splice variants compare to human variants, and what are the implications for translational research?

The mouse and human L-selectin splice variants exhibit important differences that have implications for translational research:

Mouse L-selectin splice variants (L-selectin-v1 and L-selectin-v2) contain an additional exon between exons 7 and 8, resulting in longer cytoplasmic tails (WT = 17 aa; v1 = 30 aa; v2 = 32 aa). In contrast, the human splice variant lacks exon 7, which codes for the transmembrane domain, resulting in a secreted, soluble form of L-selectin rather than a membrane-anchored protein with an extended cytoplasmic domain.

These differences have several implications for translational research:

  • Different mechanisms of regulation: The extended cytoplasmic tails in mouse variants likely affect signaling and intracellular interactions, while the human variant produces soluble L-selectin that may act as a competitive inhibitor of membrane-bound L-selectin.

  • Disease relevance: The human splice variant has increased prevalence in patients with rheumatic disease, potentially contributing to elevated soluble L-selectin levels. The mouse variants' roles in disease states are less clear due to their low endogenous expression levels (2-3% of total L-selectin mRNA).

  • Experimental design considerations: When using mouse models to study L-selectin biology for human applications, researchers must account for these species differences. Results from mouse studies may not directly translate to human biology, particularly regarding the effects of splice variants.

  • Therapeutic targeting strategies: Different approaches may be needed when targeting L-selectin in each species due to these molecular differences. Therapies targeting membrane-bound L-selectin might have different effects across species due to varying contributions from splice variants.

What molecular techniques are most effective for studying the expression and regulation of L-selectin splice variants?

Several molecular techniques are particularly effective for studying L-selectin splice variants:

  • RT-PCR with variant-specific primers: Design primers that span exon junctions unique to each splice variant for specific amplification and quantification.

  • Quantitative real-time PCR (qPCR): This allows precise quantification of the relative abundance of different splice variants. Given that mouse L-selectin splice variants constitute only 2-3% of total L-selectin mRNA, highly sensitive detection methods are necessary.

  • RNA-seq with deep coverage: This approach can detect and quantify low-abundance splice variants and potentially identify novel variants.

  • CRISPR/Cas9 genome editing: Creating specific mutations in splice junctions or regulatory elements can help elucidate the mechanisms controlling alternative splicing of L-selectin.

  • Minigene constructs: These can be used to study the splicing process in controlled conditions by introducing portions of the L-selectin gene containing relevant exons and introns into expression vectors.

  • RNA stability assays: These help determine whether differential stability of splice variant mRNAs contributes to their relative abundance.

  • Single-cell RNA analysis: This technique can reveal cell-type-specific expression patterns of splice variants that might be masked in bulk tissue analysis.

These approaches collectively provide comprehensive insights into the expression, regulation, and function of L-selectin splice variants in different cellular contexts and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.