Recombinant Mouse Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma (Tmpo)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Tmpo; Lap2; Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma; Thymopoietin isoforms beta/delta/epsilon/gamma; TP beta/delta/epsilon/gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-452
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmpo
Target Protein Sequence
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKG PPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRLEDKDDLDVTELSNEELLD QLVRYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAENTRQNGSNDSDR YSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRTEHNQSYSQAGVTETEWTSGSSTGGP LQALTRESTRGSRRTPRKRVETSQHFRIDGAVISESTPIAETIKASSNESLVANRLTGNF KHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVDRDILKEMFPYEASTPTGISAS CRRPIKGAAGRPLELSDFRMEESFSSKYVPKYAPLADVKSEKTKKRRSVPMWIKMLLFAL VAVFLFLVYQAMETNQGNPFTNFLQDTKISN
Uniprot No.

Target Background

Function
May contribute to nuclear lamina assembly, maintaining nuclear envelope structural organization. It may act as a receptor for lamin filament attachment to the inner nuclear membrane and potentially regulate DNA replication initiation through interaction with NAKAP95.
Database Links

KEGG: mmu:21917

UniGene: Mm.159684

Protein Families
LEM family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Chromosome.

Q&A

What is Tmpo and what are its primary functions in cellular biology?

Tmpo, also known as Lamina-associated polypeptide 2 (LAP2), is a group of ubiquitously expressed nuclear proteins that interact with both nuclear lamins and chromatin. Functionally, Tmpo plays several critical roles:

  • Regulation of nuclear envelope (NE) organization and architecture

  • Binding to lamin B and chromatin, contributing to nuclear structure maintenance

  • Regulation of nuclear volume increase during the cell cycle

  • Facilitation of cell cycle progression, particularly in the G1 to S phase transition

  • Involvement in cell proliferation and apoptosis regulation, as demonstrated in tumor cell studies

Tmpo is primarily located at the inner nuclear membrane, with certain isoforms (particularly LAP2α) being present in the nucleoplasm rather than membrane-bound . The protein functions by regulating nuclear lamina dynamics, which is essential for nuclear growth, proper cell cycle progression, and potentially gene expression regulation.

What are the different Tmpo isoforms in mice and how do they differ structurally and functionally?

The mouse Tmpo gene encodes several alternatively spliced protein products with distinct properties:

  • Tmpo α (alpha): 75 kDa protein, diffusely expressed within the nucleoplasm

  • Tmpo β (beta): 51 kDa protein, localized specifically to the nuclear membrane

  • Tmpo γ (gamma): 39 kDa protein, also localized to the nuclear membrane

These isoforms arise from alternative splicing of the Tmpo gene, which contains eight exons in humans . The structural organization of these proteins includes several functional domains:

  • Chromatin-binding domain (residues 1-88)

  • Lamin-binding region (residues 298-373)

  • Complete nucleoplasmic domain (residues 1-398)

Functionally, these isoforms display important differences:

  • LAP2α (alpha isoform) is unique as a non-membrane-bound nucleoplasmic protein

  • LAP2β and γ (beta and gamma isoforms) are integral membrane proteins of the inner nuclear membrane

  • The different domains enable specific interactions with chromatin, lamins, and other nuclear proteins

How does Tmpo regulate nuclear volume during cell cycle progression?

Experimental evidence from microinjection studies provides significant insights into Tmpo's role in nuclear volume regulation:

  • Microinjection of the nucleoplasmic domain of LAP2 (residues 1-398) into metaphase HeLa cells strongly inhibits nuclear volume increase without affecting nuclear envelope reassembly or transport competency

  • This effect is specifically mediated through lamin binding, as injection of just the lamin-binding region (residues 298-373) produces the same effect, while the chromatin-binding domain (residues 1-88) does not

  • Injection of the lamin-binding fragment into early G1 phase cells almost completely prevents the normal threefold nuclear volume increase that occurs over 10 hours

The mechanism appears to involve regulation of nuclear lamina dynamics:

  • Tmpo likely influences the assembly and organization of the nuclear lamina

  • This regulation affects nuclear expansion without disrupting the basic integrity of the nuclear envelope

  • The process is cell cycle-dependent, with nuclear volume increase being particularly important during G1 phase

Most significantly, inhibition of nuclear volume increase by the lamin-binding fragment during early G1 strongly inhibits entry into S phase, suggesting that achieving a certain nuclear volume is a prerequisite for DNA replication .

What protein interactions are critical for Tmpo function?

According to research findings, Tmpo/LAP2 engages in several key protein-protein interactions that are essential for its nuclear functions:

  • Lamin interactions: LAP2 binds directly to lamin B1 (LMNB1) through its specific lamin-binding region (residues 298-373) . It also interacts with lamin A (LMNA) .

  • Chromatin binding: The N-terminal domain (residues 1-88) mediates interaction with chromatin , potentially influencing chromatin organization and gene expression.

  • Barrier to autointegration factor 1: This DNA-binding protein interacts with Tmpo and may mediate some of its effects on chromatin structure .

  • AKAP8L: Identified as an interaction partner of Tmpo , suggesting potential connections to signaling pathways.

These interactions are subject to regulatory mechanisms:

  • The interaction between LAP2 and lamin B1 is regulated by phosphorylation during mitosis

  • This phosphorylation-based regulation likely facilitates nuclear envelope breakdown and reassembly during cell division

The lamin-binding capability appears to be particularly crucial for Tmpo's role in regulating nuclear volume and cell cycle progression, as demonstrated by the effects of the isolated lamin-binding domain in microinjection experiments .

What techniques are most effective for knocking down Tmpo expression in experimental models?

Based on published research, several approaches have proven effective for reducing Tmpo expression in experimental settings:

  • Lentiviral shRNA delivery: Study successfully used short hairpin RNA (shRNA) targeting Tmpo delivered via lentiviral vectors in glioblastoma cell lines (U251 and U87).

  • Knockdown efficiency verification: Real-time quantitative PCR demonstrated knockdown efficiency of approximately 60% in U251 cells and up to 90% in U87 cells at the mRNA level .

  • Protein-level confirmation: Western blot analysis confirmed corresponding reductions at the protein level .

When designing Tmpo knockdown experiments, researchers should consider:

  • Including appropriate control shRNA groups (Con-shRNA) for comparison

  • Testing multiple shRNA sequences to identify the most effective target regions

  • Accounting for potential differences in knockdown efficiency between cell lines

  • Establishing a time course for optimal knockdown assessment, as protein persistence may vary

While not explicitly mentioned in the search results, CRISPR-Cas9 gene editing could provide an alternative approach for complete Tmpo knockout, potentially offering more definitive functional insights than partial knockdown with shRNA.

How should researchers design microinjection experiments to study Tmpo function?

Microinjection experiments have yielded valuable insights into Tmpo function, particularly regarding nuclear volume regulation. Based on studies and , an effective experimental design should include:

Protein preparation:

  • Express and purify recombinant Tmpo fragments corresponding to specific functional domains:

    • Nucleoplasmic domain (residues 1-398)

    • Lamin-binding region (residues 298-373)

    • Chromatin-binding domain (residues 1-88)

Experimental conditions:

  • Inject proteins at defined cell cycle stages:

    • Metaphase (to study effects on nuclear reformation)

    • Early G1 phase (to study effects on nuclear growth)

    • S phase (to study effects on DNA replication)

Control considerations:

  • Include injection of buffer-only controls

  • Use non-binding domain fragments as negative controls

  • Compare effects of different functional domains to isolate specific mechanisms

Key measurements:

  • Nuclear volume quantification over time

  • Nuclear transport competency assays

  • Cell cycle progression tracking

  • DNA replication analysis (e.g., BrdU incorporation)

Technical parameters:

  • Optimize protein concentration (studies do not specify concentrations)

  • Ensure consistent injection volume

  • Use co-injection of fluorescent markers to identify injected cells

This approach enables researchers to dissect the specific contributions of different Tmpo domains to nuclear function and cell cycle regulation.

What assays are most appropriate for measuring Tmpo effects on cell proliferation and apoptosis?

Based on study , several complementary assays provide robust assessment of Tmpo's effects on proliferation and apoptosis:

Proliferation assays:

  • MTT assay: Measures metabolic activity as a proxy for cell number and viability

  • Colony formation assay: Evaluates long-term proliferative capacity and clonogenic potential

  • Cell cycle analysis: Flow cytometry with propidium iodide staining to determine cell cycle distribution

Apoptosis assays:

  • Flow cytometry analysis: Using appropriate markers (e.g., Annexin V/PI) to quantify apoptotic cell populations

  • Western blot analysis: Detecting apoptotic markers including:

    • Cleaved caspase-3: A key executioner of apoptosis

    • Cleaved PARP: A substrate of caspase-3 and marker for apoptotic cell death

Experimental design considerations:

  • Include appropriate time points (immediate and delayed effects)

  • Compare effects in different cell types (cancer vs. normal cells)

  • Correlate proliferation inhibition with apoptosis induction

  • Consider rescue experiments using Tmpo overexpression to confirm specificity

This multi-assay approach provides comprehensive insights into how Tmpo alterations affect cell survival and proliferation pathways, essential for understanding both its normal functions and potential as a therapeutic target.

How can researchers effectively purify and validate recombinant mouse Tmpo isoforms?

While the search results don't provide explicit purification protocols for recombinant mouse Tmpo isoforms, we can infer effective approaches based on the successful studies cited:

Expression systems:

  • Bacterial expression systems for isolated domains (as likely used in )

  • Mammalian or insect cell systems for full-length proteins with proper folding and modifications

Purification strategy:

  • Affinity chromatography using appropriate tags (His, GST, etc.)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography for final polishing and buffer exchange

Validation approaches:

  • Structural integrity:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to confirm proper folding

  • Functional validation:

    • Binding assays with purified lamins or chromatin

    • Microinjection experiments as performed in

    • In vitro nuclear assembly assays

  • Biochemical characterization:

    • SDS-PAGE and western blotting with isoform-specific antibodies

    • Mass spectrometry to confirm identity and detect potential modifications

For researchers working with specific isoforms, careful consideration of the splicing pattern and inclusion of appropriate exons is necessary to generate the desired variant (alpha, beta, gamma, etc.).

What is the relationship between Tmpo function and cell cycle checkpoints?

The search results reveal important connections between Tmpo activity and cell cycle regulation:

G1/S transition regulation:

  • Injection of the lamin-binding fragment of LAP2/Tmpo during early G1 phase strongly inhibits entry of cells into S phase

  • This effect correlates with inhibition of nuclear volume increase, suggesting nuclear size may be a checkpoint for S phase entry

  • Notably, injection during S phase has no apparent effect on ongoing DNA replication, indicating a specific G1/S checkpoint role

G2/M phase involvement:

  • Knockdown of TMPO in glioblastoma cells arrests cell cycle progression specifically at the G2/M phase

  • Cell cycle analysis showed decreased G0/G1 population and increased G2/M population after TMPO knockdown

  • This suggests Tmpo is required for proper mitotic progression

Mechanism of checkpoint regulation:

  • Tmpo appears to regulate nuclear lamina dynamics, which influences nuclear growth during interphase

  • The interaction with lamin B1 is regulated by phosphorylation during mitosis

  • Nuclear volume acquisition appears to be a prerequisite for DNA replication initiation

Cell cycle-specific protein interactions:

  • The search results note that "the interaction between LAP2 and lamin B1 is regulated by phosphorylation during mitosis"

  • This suggests cell cycle-specific modulation of Tmpo function through post-translational modifications

These findings position Tmpo as a multifunctional regulator of cell cycle progression, potentially serving as a link between nuclear architecture and cell cycle checkpoints.

How does Tmpo influence apoptotic pathways at the molecular level?

Study provides specific insights into Tmpo's relationship with apoptotic pathways in glioblastoma cells:

Experimental observations:

  • TMPO knockdown using shRNA significantly increased cell apoptosis as measured by flow cytometry

  • Western blot analysis showed upregulation of cleaved caspase-3 and cleaved PARP protein levels following TMPO knockdown

Molecular mechanism:

  • Caspase-3 activation:

    • Caspase-3 is described as "a key executioner of apoptosis" that cleaves many proteins essential for the apoptotic process

    • TMPO knockdown leads to increased cleaved (activated) caspase-3

  • PARP cleavage:

    • Poly(ADP-ribose) polymerase (PARP) is a substrate of caspase-3

    • Cleavage of PARP is established as a marker for apoptotic cell death

    • TMPO knockdown increases cleaved PARP levels

  • Pathway integration:

    • The results suggest that normal Tmpo function suppresses the intrinsic apoptotic pathway

    • When Tmpo is downregulated, this suppression is removed, allowing increased caspase activation

    • This ultimately leads to enhanced apoptotic cell death

Functional significance:

  • Tmpo appears to provide apoptotic resistance, which may contribute to its role in cancer progression

  • By inhibiting normal Tmpo function, cancer cells may become more susceptible to apoptotic cell death

  • This mechanism helps explain how Tmpo upregulation could contribute to tumor growth and survival

These findings establish a direct molecular link between Tmpo and key apoptotic executioner proteins, suggesting potential mechanisms for therapeutic intervention.

What methods are best for studying the differential roles of Tmpo isoforms?

To effectively investigate the specific functions of different Tmpo isoforms, researchers should consider the following comprehensive approach:

Expression strategies:

  • Isoform-specific constructs:

    • Design expression vectors for individual isoforms (alpha, beta, gamma)

    • Create fluorescently tagged versions for localization studies

    • Consider inducible expression systems to control timing and levels

  • Domain analysis:

    • Following the approach of studies and , create constructs for specific functional domains

    • Generate chimeric proteins swapping domains between isoforms to determine functional contributions

Functional comparison approaches:

  • Knockdown/knockout with rescue:

    • Deplete endogenous Tmpo using shRNA or CRISPR

    • Perform rescue experiments with individual isoforms

    • Compare capacity to restore normal nuclear morphology, volume, and cell cycle progression

  • Localization-function correlation:

    • Track subcellular localization of different isoforms (nuclear membrane vs. nucleoplasmic)

    • Correlate localization patterns with specific functions

    • Use mutations that alter localization to test functional consequences

Interaction profiling:

  • Isoform-specific binding partners:

    • Immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • Compare interactomes between isoforms

  • Chromatin interaction analysis:

    • ChIP-seq for chromatin-binding isoforms

    • Analyze differential genomic binding sites

Methodological considerations:

  • Use isoform-specific antibodies where possible

  • Consider tetracycline-inducible systems for controlled expression

  • Account for endogenous isoform expression when interpreting results

This multi-faceted approach would enable researchers to delineate the specific functions of different Tmpo isoforms and their relative contributions to nuclear structure and function.

What are common technical challenges when working with recombinant Tmpo proteins?

While the search results don't explicitly detail technical difficulties, we can infer several challenges based on Tmpo's characteristics:

Expression and solubility issues:

  • As nuclear membrane proteins, some Tmpo isoforms (beta, gamma) contain hydrophobic domains

  • These regions often cause aggregation and solubility problems during recombinant expression

  • Studies and used isolated domains rather than full-length proteins, potentially to avoid solubility challenges

Structural considerations:

  • Maintaining native conformation of functional domains (lamin-binding, chromatin-binding) is critical

  • Proper folding may require specific conditions or chaperones

  • Domain boundaries must be carefully defined to ensure functionality

Post-translational modifications:

  • The interaction between LAP2 and lamin B1 is regulated by phosphorylation during mitosis

  • Bacterial expression systems cannot reproduce these modifications

  • Eukaryotic expression systems may be necessary for fully functional proteins

Potential solutions:

  • Solubility enhancement:

    • Use of solubility tags (MBP, SUMO, etc.)

    • Optimization of expression conditions (temperature, induction time)

    • Addition of appropriate detergents or stabilizing agents

  • Expression system selection:

    • Insect cells for membrane proteins

    • Mammalian cells for proper modifications

    • Cell-free systems for difficult proteins

  • Domain-based approaches:

    • Focus on functional domains as in studies and

    • Design constructs based on structural predictions and known functional regions

These considerations are important when designing experiments involving recombinant Tmpo proteins to ensure that the proteins obtained are properly folded and functionally representative.

How can researchers effectively analyze nuclear volume changes in Tmpo studies?

Accurate quantification of nuclear volume is critical when studying Tmpo function, as demonstrated by studies and . The following approaches can be implemented:

Imaging techniques:

  • Confocal microscopy:

    • Z-stack acquisition of nuclei with appropriate nuclear markers

    • 3D reconstruction for accurate volume measurement

    • Time-lapse imaging to track volume changes over time

  • High-content screening:

    • Automated imaging of large cell populations

    • Software-based nuclear segmentation and measurement

    • Statistical analysis of population distributions

Quantification methods:

  • Direct volume measurement:

    • 3D reconstruction and volumetric analysis

    • Calculation based on nuclear dimensions (area × height)

  • Indirect measurements:

    • Nuclear cross-sectional area as a proxy for volume

    • Nuclear diameter measurements from multiple angles

Experimental design considerations:

  • Appropriate controls:

    • Untreated cells

    • Cells injected with control proteins or buffer

    • Parallel tracking of cell cycle markers

  • Time course analysis:

    • Studies and tracked nuclear volume over 10 hours after G1 injection

    • Multiple time points should be collected to capture dynamics

  • Cell synchronization:

    • For population studies, synchronize cells at specific cell cycle stages

    • Compare volume changes across the cell cycle

Data presentation:

  • Report both absolute values and relative changes (fold increase)

  • Include population distributions rather than just averages

  • Correlate volume measurements with functional outcomes (e.g., S phase entry)

This comprehensive approach to nuclear volume analysis will provide robust data on how Tmpo manipulations affect nuclear architecture and growth.

What statistical approaches are most appropriate for analyzing Tmpo experimental data?

Based on the experiments described in the search results, several statistical approaches are recommended for robust analysis of Tmpo studies:

For proliferation and viability studies:

  • Two-group comparisons: t-tests (paired or unpaired) for comparing control vs. Tmpo-manipulated conditions

  • Multiple group comparisons: ANOVA with appropriate post-hoc tests when testing multiple conditions or time points

  • Time course analysis: Repeated measures ANOVA or mixed models for proliferation curves

For cell cycle distribution analysis:

  • Distribution comparisons: Chi-square tests for comparing cell cycle phase distributions

  • Specific phase analysis: t-tests or ANOVA to compare percentages of cells in specific phases (G0/G1, S, G2/M)

For protein expression quantification:

  • Western blot quantification: Normalization to housekeeping proteins followed by t-tests or ANOVA

  • Fold-change analysis: When comparing relative changes in protein levels (e.g., cleaved caspase-3)

For nuclear volume measurements:

  • Continuous variable analysis: t-tests or ANOVA for comparing mean volumes

  • Distribution analysis: Kolmogorov-Smirnov tests for comparing volume distributions

  • Correlation analysis: Pearson or Spearman correlation to relate volume to other parameters

General statistical considerations:

  • Sample size determination:

    • Power analysis to determine appropriate sample sizes

    • Multiple biological replicates (minimum n=3)

  • Data presentation:

    • Report both means/medians and measures of variation (SD, SEM)

    • Include p-values and confidence intervals

    • Consider showing full data distributions (box plots, violin plots)

  • Advanced approaches:

    • Multivariate analysis for complex datasets

    • Regression analysis for dose-response relationships

What are promising areas for future research on Tmpo function in nuclear dynamics?

Based on the current knowledge presented in the search results, several promising research directions emerge:

Mechanistic investigations:

  • Lamina-chromatin interactions:

    • How does Tmpo mediate connections between the nuclear lamina and chromatin?

    • What genomic regions are specifically affected by Tmpo-dependent lamina organization?

  • Nuclear size regulation:

    • What molecular mechanisms link Tmpo-lamin interactions to nuclear volume control?

    • How is nuclear size coupled to cell cycle checkpoints through Tmpo?

  • Isoform-specific functions:

    • What are the distinct roles of nucleoplasmic (α) versus membrane-bound (β/γ) isoforms?

    • How do different isoforms coordinate to regulate nuclear dynamics?

Disease connections:

  • Cancer biology:

    • Study identified Tmpo as overexpressed in GBM and potential therapeutic target

    • Further investigate mechanisms of Tmpo upregulation in different cancer types

    • Explore targeted approaches to disrupt Tmpo function in tumors

  • Cell cycle disorders:

    • Given Tmpo's role in G1/S transition and G2/M regulation

    • Investigate connections to cell cycle dysregulation in disease states

  • Nuclear envelope pathologies:

    • Explore potential connections to laminopathies and nuclear envelope diseases

    • Investigate whether Tmpo dysfunction contributes to these conditions

Technical innovations:

  • Live-cell imaging approaches:

    • Develop tools to visualize Tmpo-lamin dynamics in real-time

    • FRET/FRAP studies to measure interaction kinetics

  • Genome engineering:

    • CRISPR-based tagging of endogenous Tmpo

    • Isoform-specific knockout models

  • Structural biology:

    • Determine high-resolution structures of Tmpo domains

    • Characterize Tmpo-lamin interaction interfaces

These research directions would significantly advance our understanding of how Tmpo regulates nuclear architecture and function, with potential implications for both basic cell biology and disease treatment.

How might Tmpo research contribute to cancer therapeutics development?

Study provides compelling evidence for Tmpo as a potential cancer therapeutic target, particularly for glioblastoma. Future research could develop this potential in several ways:

Target validation approaches:

  • Expanded cancer profiling:

    • Analyze Tmpo expression across diverse cancer types beyond GBM, lung and breast cancer

    • Correlate expression levels with patient outcomes and treatment response

    • Identify cancer subtypes most likely to respond to Tmpo-targeted approaches

  • In vivo validation:

    • Test Tmpo knockdown effects in xenograft or genetically engineered mouse models

    • Evaluate tumor growth, invasion, and metastasis

Therapeutic development strategies:

  • Small molecule inhibitors:

    • Target the lamin-binding domain (residues 298-373), which has demonstrated functional importance

    • Develop compounds that disrupt Tmpo-lamin interactions

    • Screen for molecules that induce the same cellular effects as lamin-binding fragment injection

  • Peptide-based approaches:

    • Design cell-penetrating peptides based on the lamin-binding region

    • Similar to the microinjection approach in studies and , but deliverable as therapeutics

  • RNA therapeutics:

    • Extend the shRNA approach from study toward clinical application

    • Develop siRNA or antisense oligonucleotides targeting Tmpo

Combination therapy potential:

  • Cell cycle-targeted combinations:

    • Since Tmpo knockdown arrests cells at G2/M , combine with mitotic inhibitors

    • Explore synergy with radiation, which also affects G2/M progression

  • Apoptosis enhancers:

    • Given Tmpo knockdown increases cleaved caspase-3 and PARP , combine with BH3 mimetics or other apoptosis inducers

    • Test for enhanced cancer cell killing

These approaches could translate the foundational research on Tmpo into novel cancer therapeutic strategies, potentially addressing difficult-to-treat malignancies like glioblastoma.

What are the implications of Tmpo research for understanding nuclear architecture evolution?

While the search results don't directly address evolutionary aspects of Tmpo, we can identify several important implications for understanding nuclear architecture evolution:

Evolutionary conservation:

  • Tmpo/LAP2 homologs are found across vertebrates, with the mouse and human proteins showing significant homology

  • The conservation of multiple isoforms (alpha, beta, gamma) across species suggests important distinct functions

  • The lamin-binding and chromatin-binding domains likely represent evolutionarily conserved functional modules

Nuclear size regulation:

  • The role of Tmpo in nuclear volume control has evolutionary implications

  • Nuclear size scales with cell size across species

  • Understanding how Tmpo regulates this process could reveal evolutionarily conserved mechanisms of nuclear scaling

Cell cycle connections:

  • The link between nuclear volume and S phase entry suggests an evolutionarily conserved checkpoint

  • This connection between nuclear architecture and cell cycle control may represent a fundamental aspect of eukaryotic cell biology

Future research directions:

  • Comparative genomics:

    • Analyze Tmpo gene structure and isoform diversity across diverse species

    • Identify conserved and divergent features

  • Functional conservation studies:

    • Test whether Tmpo proteins from different species can functionally substitute for each other

    • Identify species-specific adaptations in Tmpo function

  • Nuclear architecture comparison:

    • Examine how Tmpo-dependent nuclear organization varies across evolutionary lineages

    • Connect differences to species-specific requirements for nuclear function

Understanding the evolutionary aspects of Tmpo biology would provide insights into the fundamental principles governing nuclear architecture and how these have been adapted throughout eukaryotic evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.