Recombinant Mouse Lanosterol 14-alpha demethylase (Cyp51a1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Lanosterol 14-alpha Demethylase (Cyp51a1)

Recombinant Mouse Lanosterol 14-alpha demethylase, also known as Cyp51a1, is a cytochrome P450 enzyme that plays a crucial role in the biosynthesis of sterols. This enzyme is responsible for the demethylation of lanosterol, a key step in the production of cholesterol in mammals and ergosterol in fungi. The recombinant form of this enzyme is produced through genetic engineering techniques, allowing for its expression in various host systems for research and therapeutic applications.

Function and Mechanism

Cyp51a1 catalyzes the removal of the 14α-methyl group from lanosterol through a three-step monooxygenation process. Each step requires one molecule of diatomic oxygen and one molecule of NADPH (or another reducing equivalent). The process involves the conversion of the methyl group into a carboxyalcohol, then a carboxyaldehyde, which finally departs as formic acid, introducing a double bond to yield the demethylated product .

Role in Sterol Biosynthesis

In mammals, Cyp51a1 is essential for cholesterol biosynthesis, which is critical for maintaining cell membrane integrity and serving as a precursor for bile acids and steroid hormones . In fungi, this enzyme is vital for ergosterol production, which is necessary for fungal cell membrane stability and function .

Inhibition Studies

Several compounds have been studied for their ability to inhibit Cyp51a1. In mammals, inhibitors like azoles are primarily used as antifungal agents in fungi but have been explored for their effects on mammalian Cyp51a1 . Flavonoids, such as luteolin 7,3'-disulfate, have shown potential in inhibiting human Cyp51a1, suggesting their utility in cholesterol-lowering and anti-cancer therapies .

Recombinant Expression

Recombinant expression systems allow for the production of Cyp51a1 in controlled environments, facilitating detailed biochemical studies and drug development. Mouse Cyp51a1 has been expressed in various systems to study its enzymatic properties and interactions with inhibitors .

Key Features of Cyp51a1

FeatureDescription
Enzyme TypeCytochrome P450
FunctionDemethylation of lanosterol
Role in MammalsCholesterol biosynthesis
Role in FungiErgosterol biosynthesis
InhibitorsAzoles, certain flavonoids

Inhibitor Potency

InhibitorPotency Against Cyp51a1
KetoconazoleHigh (94.6% inhibition at 5 μM)
Luteolin 7,3'-disulfateModerate (50.1% inhibition at 25 μM)

References Wikidoc. Lanosterol 14 alpha-demethylase. PubMed. Lanosterol 14 alpha-demethylase (P45014DM). PubMed. Human Lanosterol 14-Alpha Demethylase (CYP51A1) Is a Putative Target for Natural Flavonoid Luteolin 7,3'-disulfate. DrugBank. Lanosterol 14-alpha demethylase. PMC. Human Lanosterol 14-Alpha Demethylase (CYP51A1) Is a Putative Target for Natural Flavonoid Luteolin 7,3'-disulfate. UniProt. Cyp51a1 - Lanosterol 14-alpha demethylase - Mus musculus (Mouse). Wikipedia. Lanosterol 14 alpha-demethylase. ASM Journals. Three-Dimensional Model of Lanosterol 14α-Demethylase from Cryptococcus neoformans.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Cyp51a1; Cyp51; Lanosterol 14-alpha demethylase; LDM; CYPLI; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Sterol 14-alpha demethylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MVLLGLLQSGGWVLGQAMEQVTGGNLLSTLLIACAFTLSLVYLFRLAVGHMVQLPAGAKS PPHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNS KNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGLNIAHFKQYVPIIEKEAK EYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWL LPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEE ISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLEQKAVCGEDLPPLTYDQLKDL NLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWAERLD FNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQIKTIWSTMLRLYEFDLINGYFP TVNYTTMIHTPENPVIRYKRRSK
Uniprot No.

Target Background

Function
Recombinant Mouse Lanosterol 14-alpha demethylase (Cyp51a1) is a cytochrome P450 monooxygenase crucial for sterol biosynthesis. It catalyzes the 14-alpha demethylation of lanosterol and 24,25-dihydrolanosterol through a sequential oxidative process. This involves converting the 14-alpha methyl group to a hydroxymethyl group, then a carboxylaldehyde, ultimately forming the delta 14,15 double bond in the sterol core and releasing formic acid. The mechanism utilizes molecular oxygen, incorporating one oxygen atom into the substrate and reducing the other to water. Two electrons are supplied by NADPH via cytochrome P450 reductase (CPR).
Gene References Into Functions
  1. Global, sex-dependent transcriptional dysregulation due to blocked cholesterol synthesis in Cyp51 knockout mice. Sterol intermediates downstream of lanosterol may regulate hepatic RORC activity. PMID: 28098217
  2. CYP51 mediates T3 and FSH-induced follicular development. PMID: 28938463
  3. Cyp51 LKO model demonstrates that steatosis develops with dietary fats in the absence of dietary cholesterol and its synthesis, while cholesterol pathway blockage leads to NASH-like features. PMID: 25739789
  4. Germ cell-specific Cyp51 ablation does not affect testicular morphology, sperm production, or reproductive performance in males. PMID: 23509403
  5. Cyp51 knockout mice demonstrate the essentiality of Cyp51 for embryogenesis, serving as a potential model for human ABS syndrome. PMID: 21705796
  6. FSH utilizes CYP51 and the MAS pathway to initiate oocyte meiosis. PMID: 19433477
  7. CYP51 is localized in testis and ovary, with highest expression in Leydig cells and spermatid acrosomes. PMID: 11988326
  8. Ejaculate sperm synthesize meiosis-activating sterols via acrosomal lanosterol 14 alpha-demethylase. PMID: 14630712
  9. CYP51, involved in cholesterol biosynthesis, undergoes immediate early regulation, influencing cellular sterol profiles. PMID: 16123160
  10. In vivo modulation exists between cholesterol synthesis (via CYP51) and transport (via LDL receptor). PMID: 18520052
  11. Crem-dependent regulation of Cyp51 in the liver results in circadian gene expression. PMID: 18775413
  12. Lanosterol 14alpha-demethylase (LDM) is linked to mouse embryo implantation and is upregulated by estrogen. PMID: 19007561
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.