Recombinant Mouse Lens fiber major intrinsic protein (Mip)

Shipped with Ice Packs
In Stock

Description

Water Permeability and Lens Transparency

  • Role in Hydration: AQP0 contributes ~80% of lens fiber membrane water permeability. Mip−/− mice exhibit 80% reduced water transport and develop cataracts by 3 weeks of age .

  • Optical Dysfunction: Heterozygous (Mip+/−) mice show reduced lens focusing power and delayed cataract onset (~24 weeks), indicating gene dosage effects .

Age-Related Modifications

  • Truncation: N- and C-terminal cleavage increases with age, reducing intact MIP levels .

  • Impact: Deamidation and phosphorylation correlate with decreased native MIP stability, potentially contributing to age-related cataracts .

Experimental Tools

  • ELISA Kits: Quantify MIP in tissue homogenates (sensitivity: 0.47 ng/ml; range: 0.78–50 ng/ml) .

  • In Vitro Studies: Used to investigate water channel kinetics and protein-protein interactions .

Disease Modeling

  • Cataract Mechanisms: Mip−/− mice model cataractogenesis linked to AQP0 deficiency .

  • Therapeutic Targets: Identifying modifiers of MIP truncation or phosphorylation could delay lens opacity .

Key Research Findings

StudyKey Outcome
MIP-Connexin InteractionMIP colocalizes with Cx45.6/Cx56 in developing lenses, aiding gap junction formation .
Adhesion FunctionMIP reconstituted in liposomes enhances membrane adhesion, independent of water transport .
Age-Dependent TruncationIntact MIP levels decline with age due to proteolytic cleavage .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mip; Palm; Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Mip
Target Protein Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGARPSDSNGQPEGTGEPVELKTQAL
Uniprot No.

Target Background

Function
Aquaporin 0 (AQP0) is a water channel protein. Its activity is downregulated by calmodulin when cytoplasmic calcium (Ca2+) levels increase. AQP0 is believed to regulate lens osmolarity and, through interactions between homotetramers in adjacent membranes, stabilize cell junctions in the eye lens core. It plays a crucial role in cell-to-cell adhesion and facilitates gap junction coupling.
Gene References Into Functions
  1. Cataractogenesis in Mip(Nat) mutants results from defects in MIP expression. PMID: 28442635
  2. Calpain hyperactivation is identified as a terminal pathogenic event in lens fiber cell death and cataract formation, despite relatively few genes showing significant differential regulation in Mip-/- lenses. PMID: 27524245
  3. AQP0, given its abundant expression at the fiber cell membrane, may anchor cytoskeletal structures, contributing to fiber cell shape, architecture, and integrity. PMID: 25960294
  4. Loss of 50% AQP0 affects lens transparency, cortical thickness, and fiber cell packing density, leading to increased extracellular space, water content, and surface area, potentially due to alterations in the ring structure. PMID: 25229686
  5. N- or C-terminal amino acid truncation does not affect AQP0's basal water permeability or adhesive functions. PMID: 24821012
  6. Ca(V) 1.2 and 1.3 channels are expressed in the lens, regulating the phosphorylation of aquaporin-0 and myosin light chain, as well as the expression of connexins 50 and 46. PMID: 23734214
  7. Phosphoserine 235's negative charge disrupts electrostatic interactions between AQP0 and calmodulin, promoting water influx through the channel. PMID: 22095752
  8. Increased water permeability via AQP1 does not compensate for AQP0 loss in TgAQP1(+/+)/AQP0(-/-) mice. Fiber cell AQP0 expression is essential for maintaining their organization and lens transparency. PMID: 21511033
  9. Kynurenine may inhibit FGF2-mediated fiber cell differentiation by suppressing crystallin and MIP26 expression. PMID: 20478381
  10. MIP plays crucial roles in establishing and maintaining uniform fiber structure and organization, which are essential for lens function. PMID: 12845708
  11. Calcium regulation of AQP0 water permeability is vital for maintaining normal lens homeostasis and development. PMID: 16515771
Database Links
Involvement In Disease
Defects in Mip are a cause of autosomal dominant cataract. The cataract Fraser mutation (Cat-Fr or Shrivelled) is a transposon-induced splicing error that substitutes a long terminal repeat sequence for the C-terminus of Mip. The lens opacity mutation (LOP) is an AA substitution that inhibits targeting of Mip to the cell-membrane.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Major component of lens fiber gap junctions.

Q&A

What expression systems are available for producing recombinant Mouse MIP?

Multiple expression systems have been validated for producing recombinant Mouse MIP, each with distinct advantages depending on research objectives:

Expression SystemCharacteristicsApplicationsProduct Form
E. coliHigh yield, lacks post-translational modifications, simple purification via His-tagStructural studies, antibody productionLyophilized powder
YeastIntermediate yield, some post-translational modificationsFunctional studiesRecombinant protein
BaculovirusHigher eukaryotic processing, better foldingFunctional studies requiring near-native conformationRecombinant protein
Mammalian cellsMost authentic post-translational modificationsStudies requiring native-like proteinRecombinant protein

For E. coli-expressed recombinant MIP, purification typically yields protein with >90% purity as determined by SDS-PAGE . The protein is usually provided as a lyophilized powder that requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol recommended for long-term storage .

How do mutations in the Mip gene affect lens development and function?

Gene trap studies in mice have clearly demonstrated the critical role of MIP in lens development and function. Mice deficient in the gene for MIP (Aqp0, Mip) develop polymorphic opacities (cataracts) by 3 weeks of age in homozygous null mice (Aqp0−/−), while heterozygous mice (Aqp0+/−) develop cataracts around 24 weeks of age .

Functional measurements reveal that:

  • Osmotic water permeability in Aqp0+/− lenses is reduced to ~46% of wild-type values

  • Osmotic water permeability in Aqp0−/− lenses is reduced to ~20% of wild-type values

  • The focusing power of Aqp0+/− lenses is significantly lower than that of wild type

These findings demonstrate that even heterozygous loss of MIP is sufficient to trigger cataractogenesis, highlighting its essential role in maintaining lens transparency .

What methodologies are most effective for assessing recombinant Mouse MIP water channel activity?

Water permeability measurements of recombinant Mouse MIP can be conducted using several methodologies, with the vesicle shrinkage assay being particularly informative:

Vesicle Shrinkage Assay Protocol:

  • Prepare lens fiber cell vesicles incorporating recombinant MIP

  • Expose vesicles to hypertonic saline (450 mM)

  • Monitor the rate of shrinkage using digital video microscopy

  • Confirm the presence of MIP in the vesicles using immunofluorescence

This methodology allows quantitative assessment of MIP's contribution to water permeability. In studies of MIP-deficient mice, this approach demonstrated that MIP accounts for approximately 80% of lens fiber cell membrane water permeability .

For more advanced structural-functional correlations, researchers should consider combining water transport assays with site-directed mutagenesis of key residues, particularly targeting the NPA motifs at positions 68-70 and 184-186 .

How can researchers effectively study the adhesion properties of recombinant Mouse MIP?

The adhesion function of MIP can be studied through liposome reconstitution experiments. When reconstituted into large unilamellar liposomes, MIP promotes adhesion between vesicles, reflecting its in vivo function in lens fiber cell organization .

Liposome Adhesion Assay Protocol:

  • Reconstitute purified recombinant MIP into large unilamellar liposomes

  • Monitor liposome aggregation through light scattering measurements

  • Visualize adhesion zones using electron microscopy

  • Quantify adhesion strength through force measurements

Ultrastructural studies suggest that MIP forms specialized contacts between mature fibers within the lens nucleus . Recent crystallographic studies have detected tongue-and-groove contours on the extracellular surface of reconstituted MIP tetramers that may facilitate fiber cell adherence in the lens . Examining these structural features in recombinant MIP can provide insights into its adhesion mechanism.

What are the critical post-translational modifications of Mouse MIP and how do they impact function?

MIP undergoes several age-dependent post-translational modifications that affect its function:

Modification TypeSpecific SitesFunctional ImpactAge-Related Changes
N-terminal truncationHeterogeneousAlters water permeabilityIncreases with age
C-terminal truncationHeterogeneousAffects cell adhesion propertiesIncreases with age
PhosphorylationPrimarily serine 235Regulates channel activityPresent in young and old lenses
DeamidationAsparagine 246 and 259Alters protein-protein interactionsComplete by 7 years (human)

Studies on human MIP demonstrate that the amount of intact MIP decreases with lens age, though the pattern of truncation remains consistent across ages from 7 to 86 years . These modifications likely contribute to age-related changes in lens optical properties.

For recombinant MIP research, it's important to consider which post-translational modifications are present in your expression system and how these may impact functional studies compared to native protein.

What techniques can be used to assess recombinant Mouse MIP tetrameric assembly and membrane integration?

Assessing the proper assembly and membrane integration of recombinant MIP requires specialized biophysical techniques:

Recommended Methodological Approach:

  • Analytical Ultracentrifugation: To determine oligomeric state in detergent solutions

  • Electron Crystallography: For visualization of 2D crystalline arrays

  • Atomic Force Microscopy: To examine surface topography of reconstituted protein

  • Proteolytic Accessibility Assays: To verify correct membrane topology

Recombinant MIP tends to form highly ordered tetragonal two-dimensional arrays upon reconstitution, which is critical for both its water channel and adhesive functions . The tetrameric assembly is essential for proper function, and disruption of this structure can lead to loss of both water permeability and adhesive properties.

How can researchers accurately model age-related changes in MIP for cataract studies?

To model age-related changes in MIP for cataract studies, researchers can employ several approaches:

In Vitro Aging Models:

  • Generate recombinant MIP variants with truncations mimicking age-related proteolysis

  • Introduce site-specific deamidation at asparagine residues 246 and 259

  • Create phosphomimetic mutations at serine 235

  • Reconstitute these modified proteins into membrane systems for functional testing

Comparative Analysis Framework:

  • Measure water permeability rates using the vesicle shrinkage assay

  • Assess focusing power using a Scantox In Vitro Assay System

  • Quantify back focal length (BFL) and BFL variability (BFLV)

  • Compare results with age-matched native lens measurements

Studies have shown that MIP modifications contribute to decreased lens optical quality with age. In heterozygous MIP-deficient mice (Aqp0+/−), the focusing power of the lens is significantly reduced compared to wild-type, despite having approximately 50% of normal MIP levels . This suggests that both quantity and quality (post-translational state) of MIP are important for maintaining lens optical properties.

What are the optimal buffer conditions for working with recombinant Mouse MIP?

Recombinant Mouse MIP requires specific buffer conditions to maintain stability and function:

Recommended Storage and Handling Conditions:

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Reconstitution: Deionized sterile water to 0.1-1.0 mg/mL

  • Long-term Storage: Add 5-50% glycerol (final concentration) and store at -20°C/-80°C

  • Working Aliquots: Store at 4°C for up to one week

  • Avoid Freeze-Thaw: Repeated freezing and thawing significantly reduces activity

For functional studies, the pH and calcium sensitivity of MIP water channel activity should be considered. MIP water permeability is regulated by both pH and calcium concentration, with reports indicating that pH-dependent gating may be physiologically relevant to lens homeostasis .

How can researchers differentiate between the water channel and adhesive functions of recombinant Mouse MIP?

Differentiating between the water channel and adhesive functions of MIP requires specialized experimental approaches:

Function-Specific Assay Strategy:

FunctionAssay MethodologyKey MeasurementsControls
Water ChannelVesicle shrinkageRate of volume change in hypertonic solutionAQP1 (positive control), lipid-only vesicles (negative control)
AdhesionLiposome aggregationLight scattering, force measurementsMutant MIP lacking adhesion domains, other membrane proteins

Careful mutagenesis studies have indicated that these functions may involve different domains of the protein. The NPA motifs (positions 68-70 and 184-186) are critical for water channel function, while the extracellular domains and particularly the tongue-and-groove contours on tetramers are implicated in adhesion .

Researchers should design mutant constructs that selectively disrupt one function while preserving the other to establish structure-function relationships for each activity.

How can researchers resolve discrepancies between in vitro and in vivo studies of recombinant Mouse MIP?

Resolving discrepancies between in vitro and in vivo MIP studies requires systematic analysis of multiple factors:

Methodological Framework for Reconciling Discrepancies:

  • Expression System Differences:

    • Compare post-translational modifications between recombinant and native MIP

    • Assess oligomeric state in different contexts

    • Evaluate lipid environment effects on protein function

  • Functional Assay Variations:

    • Standardize temperature, pH, and ionic conditions across systems

    • Use multiple complementary assays for each function

    • Establish dose-response relationships for quantitative comparisons

  • In Vivo Complexity Factors:

    • Consider developmental timing of MIP expression

    • Account for compensatory mechanisms in knockout models

    • Examine interactions with other lens proteins

Studies of MIP-deficient mice have shown that while MIP accounts for ~80% of water permeability in lens fiber cells, compensatory mechanisms involving other channels may exist. The relative loss of water permeability recorded in Aqp0+/− mouse lenses was similar in magnitude to that measured in the kidney proximal tubules of Aqp1+/− mice, suggesting common regulatory principles across aquaporin family members .

What are the critical controls needed when studying recombinant Mouse MIP in experimental systems?

Rigorous controls are essential for valid interpretation of MIP experimental data:

Essential Control Framework:

  • Protein-Specific Controls:

    • Wild-type MIP (positive control for function)

    • Non-functional MIP mutant (negative control for function)

    • AQP1 (comparison control for water permeability)

    • Membrane-only samples (background control)

  • Expression System Controls:

    • Empty vector-transfected cells

    • Host cell endogenous aquaporin assessment

    • Different tags and their effects on function

  • Functional Assay Controls:

    • Temperature controls (MIP function is temperature-dependent)

    • pH range controls (MIP is pH-sensitive)

    • Calcium concentration controls

When measuring lens optical properties, back focal length (BFL) and BFL variability (BFLV) should be quantified, with instrument reproducibility verified to be within ±0.32% of focal length . Statistical significance should be established using appropriate tests, with p≤0.05 considered significant for comparative studies .

What emerging technologies might advance our understanding of Mouse MIP structure-function relationships?

Several cutting-edge technologies show promise for deepening our understanding of MIP:

  • Cryo-Electron Microscopy: Enables visualization of MIP in near-native membrane environments at near-atomic resolution, potentially revealing dynamic conformational changes associated with water transport and cell adhesion functions.

  • Advanced Molecular Dynamics Simulations: Can model water transport through MIP channels and predict effects of mutations or post-translational modifications on function.

  • In Situ Structural Biology: Techniques like in-cell NMR could provide structural information on MIP in living cells.

  • High-Resolution Optical Techniques: Advanced lens imaging methods could correlate MIP distribution and modifications with optical properties in intact lenses.

  • CRISPR-Based Genome Editing: Could generate precise mouse models with specific MIP mutations to study structure-function relationships in vivo.

The sheer abundance of MIP in fiber cells suggests it may have functions beyond water transport that remain to be fully characterized. Recent studies point to potential roles in establishing the refractive index gradient of the lens through controlled fiber cell dehydration .

How might studies of recombinant Mouse MIP inform therapeutic strategies for cataract prevention?

Understanding the molecular mechanisms of MIP function has direct implications for cataract prevention strategies:

  • Small Molecule Stabilizers: Based on structural insights from recombinant MIP studies, compounds could be designed to stabilize MIP against age-related modifications.

  • Gene Therapy Approaches: Delivery of optimized MIP genes to the lens could potentially restore water permeability and cell adhesion in early cataract stages.

  • Post-Translational Modification Inhibitors: Compounds that specifically inhibit detrimental modifications of MIP could preserve lens transparency.

  • Biomimetic Lens Materials: Recombinant MIP studies could inform the design of artificial lens materials that mimic the optical properties of the natural lens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.