Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Leptin Receptor Overlapping Transcript-Like 1 (Leprotl1)

Leptin receptor overlapping transcript-like 1 (Leprotl1) is a gene product found across numerous species with highly conserved functions. In mice, the Leprotl1 gene is identified by the gene ID 68192 and is also known by several alternative names including HSPC112, Vps55, my047, and Endospanin-2 . The conservation of this gene across numerous vertebrate species including human, rat, goat, sheep, dog, naked mole-rat, domestic cat, chicken, and cow suggests its fundamental biological importance in vertebrate physiology . The mouse variant of Leprotl1 has been extensively characterized and serves as an important model for understanding the protein's function in mammalian systems. Research into Leprotl1 has revealed its involvement in critical physiological processes related to growth and metabolism, particularly through its interactions with growth hormone signaling pathways .

Evolutionary Conservation of Leprotl1

The Leprotl1 gene demonstrates remarkable evolutionary conservation across various species, indicating its fundamental importance in biological systems. The mouse Leprotl1 gene shares significant sequence homology with its counterparts in other mammals, suggesting that the functional roles of this protein have been preserved throughout evolutionary history . This conservation extends beyond mammals to avian species such as chickens, further emphasizing the protein's biological significance across diverse vertebrate lineages. The high degree of sequence conservation suggests that Leprotl1 plays a crucial role in basic cellular processes that have remained essential throughout vertebrate evolution.

Relationship to Leptin Signaling

Despite its name suggesting a connection to leptin signaling pathways, the precise relationship between Leprotl1 and leptin receptor function remains an area of ongoing investigation. Research indicates that Leprotl1 may influence cellular responses to metabolic signals, potentially through modulation of receptor trafficking or signaling efficacy . The "leptin receptor overlapping" terminology in its name reflects its genomic or functional relationship to leptin receptor pathways, though the exact mechanisms of this relationship continue to be elucidated through ongoing research efforts.

Protein Structure and Domains

The protein structure of Leprotl1 includes several hydrophobic regions that likely function as transmembrane domains, allowing it to integrate into cellular membranes. These structural characteristics align with its proposed function in receptor trafficking and membrane protein regulation . The amino acid composition shows a predominance of hydrophobic residues, particularly in regions predicted to span membrane bilayers. The protein's structure suggests it may function within the secretory pathway or endosomal compartments, potentially influencing the trafficking or activity of associated receptors.

Post-translational Modifications

While the search results don't specifically detail post-translational modifications of Leprotl1, the protein likely undergoes modifications typical of membrane-associated proteins, which may include glycosylation, phosphorylation, or lipid modifications that influence its localization and function. These modifications potentially play crucial roles in regulating Leprotl1's interactions with other cellular components and its participation in signaling cascades related to growth hormone responsiveness.

Production and Characteristics of Recombinant Mouse Leprotl1

Recombinant forms of mouse Leprotl1 have been developed for research applications, allowing scientists to study the protein's structure and function in controlled experimental settings. One prominent example is the recombinant full-length mouse Leprotl1 protein with an N-terminal His tag, expressed in E. coli bacterial systems . This recombinant protein encompasses the entire 131 amino acid sequence of native Leprotl1, making it suitable for a variety of research applications investigating the protein's structure and function.

Recombinant Protein Production Methods

The production of recombinant mouse Leprotl1 typically employs bacterial expression systems, particularly E. coli, which offer efficient protein synthesis and straightforward purification protocols . The addition of an N-terminal histidine tag facilitates purification through metal affinity chromatography, allowing for the isolation of relatively pure protein preparations. Following expression and purification, the recombinant protein is typically lyophilized to create a stable powder form that can be reconstituted for experimental use.

Physical and Chemical Properties

The recombinant mouse Leprotl1 protein demonstrates specific physical and chemical properties that influence its handling and application in research settings. These characteristics are summarized in the following table:

PropertyDescription
Amino Acid Length131 amino acids (full-length)
Molecular WeightNot specified in search results
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, aliquoting recommended
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Stability Enhancer5-50% glycerol recommended for long-term storage

This recombinant protein preparation demonstrates high purity and stability when properly stored, making it suitable for various research applications including structural studies, functional assays, and antibody production .

Regulation of Growth Hormone Signaling

The most well-documented function of Leprotl1 is its role in modulating growth hormone signaling. Experimental evidence indicates that Leprotl1 expression can attenuate cellular responses to growth hormone, leading to reduced growth hormone-dependent signaling in target tissues, particularly the liver . This regulatory function may involve direct interactions with growth hormone receptors or modulation of downstream signaling components. The ability of Leprotl1 to influence growth hormone signaling pathways positions it as a potentially important regulator of body growth and metabolic regulation.

Relationship with LEPROT

Studies have demonstrated that Leprotl1 functions cooperatively with its related protein LEPROT to influence growth and metabolism . Both proteins appear to participate in similar cellular pathways, potentially through complementary mechanisms that collectively regulate receptor trafficking or signaling efficacy. This cooperative relationship suggests that the two proteins may have evolved to provide nuanced regulation of growth and metabolic pathways through overlapping but distinct molecular mechanisms.

Research Applications and Available Tools

The study of mouse Leprotl1 has been facilitated by the development of various research tools and reagents. Commercial suppliers offer a range of products designed for investigating Leprotl1 expression, function, and interactions in experimental systems. These tools enable researchers to manipulate Leprotl1 levels, detect its presence in biological samples, and study its functional roles in cellular processes.

Antibodies for Leprotl1 Detection

Several antibodies have been developed for the detection of Leprotl1 in experimental settings. These include:

  1. Anti-LEPROTL1 antibody produced in rabbit (HPA047911) - Designed for human immunohistochemistry applications, affinity isolated, and supplied in buffered aqueous glycerol solution .

  2. Anti-LEPROTL1 (N-terminal) antibody produced in rabbit (SAB2109205) - Suitable for western blot applications across multiple species including bovine, canine, goat, guinea pig, horse, human, mouse, and rabbit .

These antibodies provide researchers with tools to detect Leprotl1 expression in tissues and cells, facilitating studies of its distribution, regulation, and potential functions.

Gene Knockdown and Manipulation Tools

For functional studies of Leprotl1, several gene knockdown and manipulation tools are commercially available:

  1. siRNA (small interfering RNA) - Predesigned siRNAs targeting Leprotl1 are available, designed using proprietary algorithms to ensure effective knockdown of gene expression .

  2. shRNA (short hairpin RNA) - Collections of validated shRNA constructs targeting Leprotl1 are available for stable knockdown experiments .

  3. esiRNA (endoribonuclease-prepared siRNA) - MISSION® esiRNA targeting mouse Leprotl1 (EMU013701) provides an alternative approach for gene knockdown studies .

  4. Targeted allele models - Mouse models with targeted modifications of the Leprotl1 gene have been developed, such as the Leprotl1<tm1Lex> allele, facilitating in vivo studies of gene function .

These molecular tools enable researchers to modulate Leprotl1 expression in experimental systems, allowing investigation of its functional roles and physiological significance.

Recombinant Protein Products

Several recombinant Leprotl1 protein products are commercially available for research applications:

  1. Recombinant Full Length Mouse Leprotl1 Protein with N-terminal His tag (RFL36488MF) - Expressed in E. coli, covering the complete 131 amino acid sequence .

  2. Recombinant Mouse Leprotl1 Protein with Myc/DDK tags (Leprotl1-3775M) - An alternative tagged version of the protein for specific experimental applications .

These recombinant protein preparations provide researchers with purified Leprotl1 for use in various applications, including structural studies, interaction assays, and antibody production.

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we are happy to accommodate any special requirements you may have. Please indicate your preferred format in the order notes and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Leprotl1; Leptin receptor overlapping transcript-like 1; Endospanin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Leprotl1
Target Protein Sequence
MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW
Uniprot No.

Target Background

Function
Leptin receptor overlapping transcript-like 1 (Leprotl1) negatively regulates growth hormone (GH) receptor cell surface expression in the liver. It may play a crucial role in the liver's resistance to GH during periods of reduced nutrient availability.
Gene References Into Functions
  1. Gene browse revealed a quantitative trait locus (QTL) for body weight/size, genes involved in the immune system, and two key protein-coding genes involved in glucose homeostasis, Mboat4 and Leprotl1. The heritability and coefficient of genetic variance (CVg) were 0.49 and 0.31 for females, while for males, these values were 0.34 and 0.22, respectively. PMID: 27807798
  2. The increased expression of fibroblast growth factor 21 (FGF21) during chronic undernutrition inhibits GH action on chondrocytes by activating LEPROT and LEPROTL1. PMID: 23940039
  3. Both LEPROT and LEPROTL1 expression were regulated in the liver by physiological and pathological changes in glucose homeostasis. PMID: 19907080
Database Links
Protein Families
OB-RGRP/VPS55 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Leptin receptor overlapping transcript-like 1 (Leprotl1) and how is it related to endospanin-2?

Leprotl1 (Leptin receptor overlapping transcript-like 1) is a small integral membrane protein that belongs to the endospanin family. It is homologous to endospanin-1 (also known as LEPROT or OB-RGRP) and is often referred to as endospanin-2. Both proteins are tetraspanning membrane proteins that localize primarily in endosomes and the trans-Golgi network . Structurally, Leprotl1 shares the four-transmembrane domain architecture characteristic of endospanins, with both N- and C-termini facing the cytoplasm. In experimental systems, fluorescently tagged Leprotl1 can be observed translocating to the plasma membrane before being rapidly internalized into early endosomes, demonstrating its dynamic cellular distribution pattern . Unlike many membrane proteins, Leprotl1 does not appear to recycle extensively back to the trans-Golgi network after internalization, suggesting a specific role in the endocytic pathway.

How does Leprotl1 regulate receptor trafficking and cell surface expression?

Leprotl1 functions as a post-internalization regulator of specific receptor trafficking pathways. Mechanistically, Leprotl1 does not affect the initial internalization rate of receptors from the cell surface but instead influences their fate after endocytosis . For receptors like the leptin receptor (OB-R) and growth hormone receptor (GHR), Leprotl1 promotes their trafficking toward lysosomal degradation rather than recycling back to the plasma membrane . When Leprotl1 is depleted through shRNA-mediated silencing, researchers observe decreased receptor degradation and enhanced receptor recycling to the cell surface, resulting in increased receptor abundance at the plasma membrane . This function appears highly specific, as Leprotl1 depletion does not similarly affect the trafficking of other receptors such as transferrin receptor or EGFR . The regulatory mechanism involves Leprotl1's ability to influence sorting decisions at early endosomes, directing cargo proteins toward late endosomes/lysosomes rather than recycling endosomes, as evidenced by reduced co-localization of internalized receptors with LAMP-1-positive compartments in Leprotl1-depleted cells .

How do LEPROT and LEPROTL1 cooperatively function in cellular systems?

LEPROT and LEPROTL1 display cooperative activity in regulating receptor trafficking and signaling. Co-expression studies have demonstrated that when both proteins are simultaneously present, their inhibitory effects on receptor cell surface expression are significantly enhanced compared to either protein alone . In COS-7 cells co-transfected with both LEPROT and LEPROTL1, cell-surface GH binding was reduced to a greater extent than with single transfection of either gene . Similarly, transgenic mice expressing both human LEPROT and LEPROTL1 exhibit more pronounced phenotypes than single transgenic animals, including more severe growth retardation and greater reduction in plasma IGF1 levels . This cooperative effect suggests that the two proteins may function through complementary mechanisms or form functional complexes. While LEPROT primarily decreases plasma membrane receptor abundance without significantly affecting soluble receptor fragments, LEPROTL1 both reduces cell-surface receptor expression and decreases soluble receptor shedding by approximately 50% . This differential effect on receptor processing indicates distinct but cooperative modes of action between these two related proteins.

What are the most effective methods for studying Leprotl1 function in vitro?

For investigating Leprotl1 function in vitro, researchers should employ a combination of gene manipulation and trafficking analyses. The most reliable approach involves:

  • RNA interference: Utilizing shRNA or siRNA targeting Leprotl1 in cell culture systems such as H4IIE hepatocytes or COS-7 cells has proven effective for studying loss-of-function effects . When designing silencing constructs, target sequences should be carefully selected to ensure specificity for Leprotl1 without affecting LEPROT expression.

  • Overexpression systems: Transfection with vectors expressing tagged (e.g., GFP or FLAG) Leprotl1 allows for visualization of subcellular localization and trafficking dynamics. Dose-dependent effects can be assessed by transfecting increasing amounts of Leprotl1 expression vectors .

  • Receptor trafficking assays: Cell-surface receptor expression can be quantified using [125I]-ligand binding assays at 4°C, which specifically measures plasma membrane receptors . For dynamic trafficking studies, antibody uptake experiments are particularly useful - cells expressing epitope-tagged receptors are incubated with antibodies at 37°C, allowing internalization to be tracked over time through immunofluorescence microscopy .

  • Colocalization analysis: Immunofluorescence microscopy with markers for specific cellular compartments (EEA1 for early endosomes, LAMP-1 for lysosomes) enables determination of Leprotl1's subcellular distribution and its effects on receptor trafficking pathways .

  • Signaling assays: Measuring phosphorylation of downstream signaling proteins (e.g., STAT5 for GH signaling) and transcriptional targets (e.g., Socs2) provides functional readouts of Leprotl1's effects on receptor activity .

These methodologies should be implemented with appropriate controls, including non-targeted siRNAs and empty vector transfections, to ensure observed effects are specific to Leprotl1 manipulation.

What considerations are important when designing in vivo studies with Leprotl1 transgenic or knockout models?

When designing in vivo studies with Leprotl1 transgenic or knockout models, researchers should consider several critical factors:

  • Transgene design and expression regulation: For transgenic models, the choice of promoter significantly impacts expression patterns. The research by Touvier et al. utilized the cytomegalovirus enhancer with chicken β-actin promoter sequence to drive ubiquitous expression of human LEPROTL1 . Tissue-specific promoters may be advantageous for studying Leprotl1 function in specific organs like liver.

  • Genetic background standardization: Maintaining transgenic lines on a consistent genetic background (e.g., C57BL/6J as used in published work) is essential for reducing variability and ensuring reproducibility . When comparing phenotypes, littermate controls should be used whenever possible.

  • Validation of multiple independent lines: To control for positional integration effects, at least two independent transgenic lines should be characterized to confirm consistent phenotypes, as demonstrated in published LEPROTL1 transgenic mouse studies .

  • Phenotypic characterization timeline: Growth measurements should be conducted at regular intervals (e.g., weekly from birth to 10 weeks) to capture developmental effects of Leprotl1 modulation . For physiological assessment, parameters such as plasma IGF1, GH levels, and glucose concentrations provide important readouts of Leprotl1's metabolic effects.

  • Challenge studies: Given Leprotl1's role in metabolic regulation, subjecting models to metabolic challenges (fasting, high-carbohydrate diet, or STZ-induced diabetes) can reveal conditional phenotypes that might not be apparent under normal conditions .

  • Functional validation: Assessing GH sensitivity through acute GH administration (e.g., 0.5 mg/kg via intravenous injection) followed by measurement of liver STAT5 phosphorylation and target gene expression provides critical functional data .

These methodological considerations ensure rigorous assessment of Leprotl1's physiological roles while controlling for technical variables that could confound interpretation.

How can researchers effectively measure changes in Leprotl1 expression under different physiological conditions?

To accurately measure changes in Leprotl1 expression under varying physiological conditions, researchers should implement a multi-faceted approach:

  • Real-time quantitative PCR (RT-qPCR): For mRNA quantification, carefully designed primers specific to Leprotl1 that avoid cross-reactivity with the related LEPROT gene are essential. Expression data should be normalized to multiple reference genes that maintain stability under the experimental conditions being tested (e.g., fasting, diabetes) .

  • Western blotting: Protein-level quantification requires validated antibodies specific to Leprotl1. Given the membrane protein nature of Leprotl1, sample preparation should include appropriate detergent-based extraction methods to ensure complete solubilization. Separation on gradient gels may improve resolution of this small protein .

  • Immunohistochemistry/immunofluorescence: For tissue localization studies, perfusion fixation techniques followed by careful validation of antibody specificity using appropriate controls (transgenic overexpression or knockout tissues) ensures reliable detection .

  • Experimental design for physiological studies: When examining regulation under metabolic conditions:

    • Fasting protocols should be standardized (e.g., 6-hour fast for baseline measurements, longer fasting periods for challenge studies)

    • Refeeding experiments should control diet composition, particularly carbohydrate content

    • In diabetes models, blood glucose levels should be monitored to confirm diabetic state before expression analysis

    • Insulin treatments should include dose-response assessments to determine threshold concentrations for Leprotl1 regulation

  • In vitro models for regulatory studies: Cell culture systems like H4IIE hepatocytes allow for controlled hormone exposure to dissect regulatory mechanisms. Researchers should test multiple time points and concentrations of hormones like insulin to establish dose and time dependencies of Leprotl1 expression changes .

This comprehensive approach enables reliable detection of physiologically relevant changes in Leprotl1 expression across experimental paradigms.

How does Leprotl1 specificity for certain receptors contrast with its lack of effect on others?

The receptor specificity of Leprotl1 represents one of its most intriguing research aspects. Current evidence indicates that Leprotl1 regulates a surprisingly restricted set of membrane proteins, primarily leptin receptor (OB-R) and growth hormone receptor (GHR), while having no significant effect on others like transferrin receptor and EGFR . This specificity appears to be determined by:

  • Receptor structural determinants: Research suggests that specific domains or motifs within receptors likely mediate their susceptibility to Leprotl1 regulation. For example, mutations in endocytosis motifs of OB-Ra abolish the effects of Leprotl1 depletion on receptor surface expression, indicating that Leprotl1 interacts with the endocytic machinery . Comparative structural analysis between Leprotl1-regulated receptors (OB-R, GHR) and unaffected receptors (EGFR) may reveal critical recognition sequences.

  • Trafficking pathway differences: Leprotl1-sensitive receptors appear to share common post-endocytic trafficking routes that are distinct from insensitive receptors. While EGFR undergoes efficient ligand-induced sorting to lysosomes independently of Leprotl1, OB-R and GHR degradation shows strong Leprotl1 dependence . This suggests Leprotl1 functions within specific endosomal sorting pathways.

  • Experimental assessment of specificity: To investigate this selectivity, researchers should conduct systematic screens of membrane protein trafficking. Cell-surface biotinylation assays combined with mass spectrometry in Leprotl1-depleted versus control cells can identify the full repertoire of Leprotl1-regulated proteins. Complementary approaches, including antibody uptake assays and lysosomal inhibitor studies with multiple receptor types, can validate differential effects on post-endocytic sorting decisions.

Understanding this remarkable specificity may reveal fundamental principles about specialized trafficking pathways and potentially identify common features among metabolically regulated receptors.

What are the molecular mechanisms through which Leprotl1 regulates post-internalization sorting decisions?

The precise molecular mechanisms governing Leprotl1's control over post-internalization receptor sorting remain incompletely understood, but several experimental approaches can address this knowledge gap:

  • Protein interaction networks: Identifying Leprotl1 binding partners through approaches such as co-immunoprecipitation followed by mass spectrometry can reveal associations with components of the endosomal sorting machinery. The yeast homologue of endospanin-1 (Vps55p) interacts with Vps68p to regulate vacuolar protein sorting, suggesting conserved protein complexes may function in mammalian systems . Proximity labeling methods like BioID can identify transient interactions within the endosomal compartment.

  • Endosomal subdomain localization: Super-resolution microscopy can determine whether Leprotl1 localizes to specific endosomal subdomains associated with particular sorting pathways. For example, localization to endosomal sorting complexes required for transport (ESCRT)-positive regions would suggest involvement in lysosomal targeting mechanisms.

  • Post-translational modifications: Investigation of whether Leprotl1 undergoes regulated modifications (phosphorylation, ubiquitination) that could control its activity is warranted. Quantitative phosphoproteomic analysis of Leprotl1 under different metabolic conditions may reveal regulatory sites.

  • Structure-function analysis: Systematic mutagenesis of Leprotl1 domains can identify regions critical for its trafficking functions. The four transmembrane domains likely play important roles in membrane insertion and protein-protein interactions, while cytoplasmic regions may interact with sorting machinery components.

  • Dynamic imaging: Live-cell imaging using dual-color fluorescence of Leprotl1 and cargo receptors can visualize the temporal relationship between Leprotl1 activity and sorting decisions. Photoactivatable fluorescent tags can be particularly informative for tracking receptor fate from specific endosomal populations.

These complementary approaches can elucidate how Leprotl1 interfaces with the cellular machinery to direct specific receptors toward degradative rather than recycling pathways.

How does the relationship between LEPROT and LEPROTL1 expression reflect evolutionary conservation of function?

The evolutionary relationship between LEPROT and LEPROTL1 provides insight into their functional significance across species:

  • Genomic organization conservation: The LEPROT gene shows a distinctive genomic arrangement, being encoded within an intron of the leptin receptor gene in both humans and rodents . This overlapping gene structure suggests strong evolutionary pressure to maintain the physical linkage between these genes. Comparative genomic analysis across species can determine when this arrangement emerged and if it correlates with specific metabolic adaptations.

  • Functional conservation in lower organisms: The yeast endospanin homolog Vps55p functions in vacuolar protein sorting, suggesting that the fundamental role in membrane trafficking is ancient . Experimental complementation studies can test whether human LEPROTL1 can rescue phenotypes in yeast lacking Vps55p, which would confirm functional conservation despite sequence divergence.

  • Differential tissue expression patterns: While sharing similar cellular functions, LEPROT and LEPROTL1 may have evolved distinct tissue expression profiles or regulatory mechanisms. Comprehensive transcriptomic analysis across tissues and species can map these differences and identify tissue-specific functions.

  • Duplications and specialization: The presence of two Vps68p homologs in humans suggests that the entire complex may have undergone duplication during evolution . This raises the question of whether LEPROT and LEPROTL1 have subdivided ancestral functions or developed new specialized roles. Comparative studies of substrate specificity across species can address this question.

  • Regulation by nutritional states: Both genes show responsiveness to metabolic conditions like fasting and diabetes in mammals , suggesting their regulation may be part of an evolutionarily conserved response to nutrient availability. Examining this regulatory pattern across diverse species can reveal when this metabolic responsiveness emerged.

Understanding these evolutionary relationships provides context for interpreting the functional significance of these proteins in modern mammalian systems and may reveal fundamental principles about membrane trafficking evolution.

What is the evidence for Leprotl1's role in metabolic regulation and potential implications for metabolic disorders?

The evidence for Leprotl1's involvement in metabolic regulation comes from multiple experimental systems and suggests potential relevance to metabolic disorders:

These findings suggest Leprotl1 may function as a molecular link between nutritional signals and hormone sensitivity, potentially contributing to the development of hormone resistance states in metabolic disorders. Future research should investigate whether Leprotl1 dysregulation occurs in human metabolic diseases and whether targeting this pathway might have therapeutic potential.

How does Leprotl1 contribute to growth hormone resistance in models of type 1 diabetes and fasting?

Leprotl1 appears to play a mechanistic role in the development of growth hormone resistance observed during fasting and in type 1 diabetes models:

  • Expression correlation with GH resistance states: Hepatic Leprotl1 expression increases significantly during fasting and in streptozotocin-induced diabetic mice, precisely matching conditions characterized by hepatic GH resistance . This temporal and condition-specific correlation suggests a potential causal relationship.

  • Phenotypic similarities: Transgenic mice overexpressing Leprotl1 display reduced plasma IGF1 levels that are quantitatively similar to those observed in streptozotocin-induced diabetic wild-type mice (approximately 240 ng/ml in both models) . This striking similarity in IGF1 suppression, a key marker of hepatic GH resistance, supports Leprotl1's role in this pathophysiological process.

  • Cellular mechanism of action: Leprotl1 reduces cell-surface GHR abundance by approximately 70% in experimental systems, thereby limiting cellular GH sensitivity . This mechanism directly explains how increased Leprotl1 expression could contribute to the reduced GH responsiveness observed in fasting and diabetic states.

  • Insulin regulation: The negative regulation of Leprotl1 expression by insulin provides a mechanistic link between insulin deficiency in type 1 diabetes and enhanced Leprotl1 activity . The absence of insulin's suppressive effect on Leprotl1 in diabetic states would be expected to increase Leprotl1 levels, thereby reducing GH sensitivity.

  • Functional impact on GH signaling: Both in transgenic mice and in cellular models, increased Leprotl1 expression impairs GH-induced STAT5 phosphorylation and target gene induction, recapitulating the signaling defects observed in diabetic animals .

These multiple lines of evidence support a model where increased Leprotl1 expression during insulin-deficient states contributes to hepatic GH resistance by reducing cell-surface GHR levels. This mechanism may represent an adaptive response to conserve energy during nutrient limitation but becomes maladaptive in pathological conditions like poorly controlled diabetes.

What therapeutic opportunities might arise from modulating Leprotl1 activity in metabolic disorders?

Modulating Leprotl1 activity presents several potential therapeutic opportunities for metabolic disorders, based on its demonstrated functions and regulatory patterns:

  • Enhancing GH sensitivity: Targeted inhibition of Leprotl1 in liver could potentially increase hepatic GH sensitivity in conditions characterized by GH resistance, such as poorly controlled type 1 diabetes . By increasing cell-surface GHR expression, this approach might restore IGF1 production and ameliorate growth impairment in pediatric patients with diabetes.

  • Leptin sensitization: Given Leprotl1's role in regulating leptin receptor trafficking, its inhibition might enhance leptin sensitivity . This could potentially benefit obesity treatment, similar to the previously demonstrated effect for endospanin-1 (LEPROT), where lentivirus-delivered shRNA targeting endospanin-1 in the arcuate nucleus prevented diet-induced obesity in mice .

  • Addressing specific hormone resistances: The selective action of Leprotl1 on specific receptors (currently known to include GHR and OB-R) suggests that its modulation might allow targeted intervention for specific hormone resistance states without broadly affecting membrane protein trafficking .

  • Therapeutic targeting approaches:

    • RNA interference: Liver-targeted siRNA or antisense oligonucleotides against Leprotl1 could reduce its expression in a tissue-specific manner

    • Small molecule modulators: Compounds that disrupt Leprotl1's interaction with trafficking machinery components could inhibit its function

    • Peptide-based approaches: Interfering peptides derived from interaction domains between Leprotl1 and target receptors might block its regulatory effects

  • Biomarker potential: Leprotl1 expression levels could potentially serve as biomarkers for hormone sensitivity states, helping to identify patients who might benefit from targeted interventions.

These therapeutic possibilities require further investigation, including the development of specific inhibitors, validation in preclinical models, and careful assessment of potential off-target effects. The tissue-specific and receptor-selective nature of Leprotl1 action suggests that its modulation might offer advantages over direct hormone replacement therapies.

What are the key unanswered questions about Leprotl1 that require further investigation?

Despite significant progress in understanding Leprotl1 function, several critical knowledge gaps remain that warrant focused research efforts:

  • Complete receptor specificity profile: While Leprotl1 has been shown to regulate leptin receptor and growth hormone receptor trafficking, a comprehensive analysis of all potential target receptors has not been conducted . Systematic proteomic approaches are needed to identify the full spectrum of membrane proteins affected by Leprotl1 modulation.

  • Tissue-specific functions: Most studies have focused on Leprotl1's role in liver and cultured cell lines, but its function in other metabolically active tissues requires investigation. Tissue-specific knockout models would be valuable for dissecting the relative importance of Leprotl1 action across different organs.

  • Molecular interaction partners: The specific protein complexes through which Leprotl1 influences receptor sorting decisions remain largely unknown. Identification of these interactions would provide mechanistic insight and potential targets for therapeutic intervention.

  • Regulation beyond transcription: While transcriptional regulation of Leprotl1 by insulin and metabolic states has been documented , potential post-translational regulation through phosphorylation, ubiquitination, or other modifications remains unexplored.

  • Role in human metabolic diseases: Studies in human patients with metabolic disorders (obesity, diabetes, growth disorders) are needed to determine whether altered Leprotl1 expression or function contributes to disease pathophysiology.

  • Cooperation with LEPROT: Although cooperative effects between LEPROT and LEPROTL1 have been observed , the molecular basis for this cooperation and whether they form functional complexes requires further investigation.

  • Developmental roles: The contribution of Leprotl1 to growth regulation during development versus its role in adult metabolic homeostasis needs clarification through stage-specific genetic manipulations.

Addressing these questions will significantly advance understanding of Leprotl1's physiological importance and its potential as a therapeutic target in metabolic disorders.

What novel experimental approaches might advance our understanding of Leprotl1 biology?

Several cutting-edge experimental approaches could significantly advance Leprotl1 research:

  • CRISPR-based functional genomics: Genome-wide CRISPR screening in reporter systems designed to monitor GHR or OB-R surface expression could identify genes that interact functionally with Leprotl1. This approach might uncover components of the trafficking machinery specifically involved in Leprotl1-mediated sorting decisions.

  • Proximity labeling proteomics: BioID or APEX2 fusions with Leprotl1 expressed in relevant cell types would allow identification of proteins residing in close proximity to Leprotl1 in living cells, potentially revealing transient interaction partners involved in membrane trafficking.

  • Cryo-electron microscopy: Structural studies of Leprotl1 alone and in complex with interaction partners could provide atomic-level insights into its function and inform structure-based drug design for therapeutic applications.

  • Single-molecule imaging: Live-cell super-resolution microscopy tracking individual receptor molecules in control versus Leprotl1-manipulated cells could reveal detailed kinetics of sorting decisions and clarify how Leprotl1 influences receptor fate determination.

  • Tissue-specific and inducible genetic models: Conditional knockout or overexpression systems allowing temporal and spatial control of Leprotl1 expression would help distinguish developmental from homeostatic functions and identify tissue-specific roles.

  • Organoid systems: Patient-derived hepatic or hypothalamic organoids with genetic manipulation of Leprotl1 could provide human-relevant models for studying its function in three-dimensional tissue contexts.

  • Multi-omics integration: Combining transcriptomics, proteomics, and phosphoproteomics data from tissues with altered Leprotl1 expression under various metabolic conditions could reveal downstream pathways and regulatory networks.

  • In vivo trafficking studies: Adaptation of techniques such as HaloTag pulse-chase labeling for in vivo use could enable visualization of receptor trafficking dynamics in intact tissues with modified Leprotl1 expression.

These innovative approaches would complement traditional methods and potentially accelerate discovery of Leprotl1's fundamental mechanisms and physiological significance.

How might research on Leprotl1 intersect with emerging areas of metabolic research?

Leprotl1 research has significant potential to intersect with and contribute to several emerging areas in metabolic science:

  • Integration of nutrient sensing and hormone action: Leprotl1's responsiveness to metabolic states positions it as a potential integrator of nutritional signals and hormone sensitivity . This aligns with growing interest in understanding how cells coordinate multiple inputs to maintain metabolic homeostasis. Investigation of Leprotl1's role in nutrient-sensing pathways such as mTOR could reveal novel regulatory mechanisms.

  • Selective hormone resistance: The concept that hormone resistance can develop selectively for specific hormones in metabolic disorders is gaining recognition. Leprotl1's receptor-specific action provides a potential molecular explanation for such selectivity . Comparative studies of multiple hormone signaling pathways in models with altered Leprotl1 expression could advance understanding of differential hormone sensitivity.

  • Membrane trafficking in metabolic adaptation: Emerging evidence suggests that regulated membrane trafficking of nutrient transporters and metabolic receptors represents a critical adaptation mechanism. Leprotl1 research contributes to this field by elucidating specific trafficking machinery involved in metabolic receptor sorting .

  • Inter-organ communication: The endocrine system coordinates metabolism across tissues, and Leprotl1's regulation of hormonal sensitivity could influence this communication network. Studies examining how Leprotl1 modulation in one tissue affects metabolic parameters in others would inform our understanding of systemic metabolic regulation.

  • Chronobiology of metabolism: Circadian regulation of metabolic processes is an active research area. Investigating whether Leprotl1 expression and activity display circadian patterns could connect receptor trafficking dynamics to daily metabolic rhythms.

  • Therapeutic targeting of intracellular trafficking: As the field moves toward developing drugs targeting specific intracellular processes rather than receptors themselves, Leprotl1 represents a potential target for modulating receptor availability without directly affecting hormone levels or receptor binding properties .

By connecting receptor trafficking mechanisms to whole-body metabolic regulation, Leprotl1 research bridges cellular and physiological levels of investigation, potentially contributing to an integrated understanding of metabolic homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.