Recombinant Mouse LETM1 domain-containing protein LETM2, mitochondrial (Letm2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Letm2; LETM1 domain-containing protein LETM2, mitochondrial; LETM1 and EF-hand domain-containing protein 2; Leucine zipper-EF-hand-containing transmembrane protein 1-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-480
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Letm2
Target Protein Sequence
CSHFPSLAFLHLPDSHLRTAYIKNCGSRKYSYPSLTGNNKVHPLRTRLPQKLHTTCWLQH VPGKPQLEQTGKPKAASPQPTKEAKTETTEEKRSLRQKIVNELKYYYKGFSLLWIDTKVA ARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPS TFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASSQLSSYVKQVQTGHK PSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADD EIIAKEGVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLSR TFYLIDVKPKPIELPPNIETPKPNLGIPTPPPPESKENLTDSAPQLKGTKDEEFIQLPPV PSSLIAPAATISKEAILQAKSQETSQNSKADSKGA
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What structural features distinguish LETM2 from LETM1?

LETM2 shares a leucine zipper motif and EF-hand domains with LETM1 but lacks conserved proline residues in its transmembrane domains . Comparative analyses of recombinant mouse LETM2 reveal a molecular weight of 45 kDa, contrasting with LETM1’s 70–83 kDa range, due to differences in post-translational modifications and presequence cleavage . Methodologically, distinguishing these paralogs requires:

  • Domain-specific antibodies: Western blotting using antibodies targeting the divergent C-terminal regions .

  • Subcellular fractionation: Confirming mitochondrial inner membrane localization via differential centrifugation and protease protection assays .

  • Topological mapping: Employing in situ epitope tagging to resolve conflicting reports about N-terminal orientation (matrix vs. intermembrane space) .

Table 1: Structural comparison of LETM1 and LETM2

FeatureLETM1LETM2
Molecular weight70–83 kDa45 kDa
EF-hand domainsTwo (578–590, 676–698)One (position varies)
Tissue distributionUbiquitousTestis-specific
Key residuesProline-rich TM domainLeucine zipper motif
Functional roleK+/H+ exchange, Ca2+ uptakeCristae remodeling, PI3K-Akt
Data derived from .

How is LETM2’s mitochondrial localization experimentally validated?

Three methodological approaches are critical:

  • Co-localization assays: Transfect cells with LETM2-GFP constructs and stain with MitoTracker Red, followed by confocal microscopy .

  • Protease sensitivity testing: Treat isolated mitochondria with proteinase K under isotonic vs. hypotonic conditions. LETM2’s resistance to protease in isotonic buffers confirms inner membrane localization .

  • Immunoelectron microscopy: Use gold-labeled antibodies to visualize LETM2 within cristae structures .

What experimental models resolve contradictions in LETM2’s ion transport mechanism?

LETM2’s role in ion transport remains debated due to conflicting reports about its Ca2+/H+ vs. K+/H+ exchange activity . To address this:

  • Electrophysiological recordings: Incorporate recombinant LETM2 into planar lipid bilayers and measure currents under varying Ca2+/K+ gradients .

  • Fluorescent ion indicators: Use Rhod-2 (Ca2+) and BCECF (pH) in LETM2-knockdown cells to quantify ion flux dynamics .

  • Liposome reconstitution: Monitor membrane potential changes in proteoliposomes containing purified LETM2 using voltage-sensitive dyes .
    A 2022 study demonstrated that LETM2 knockdown in PDAC cells reduces mitochondrial Ca2+ uptake by 62% (p < 0.01), supporting its role in Ca2+ homeostasis .

How does LETM2 regulate the PI3K-Akt pathway in cancer?

In PDAC, LETM2 overexpression increases phosphorylated Akt (Ser473) by 3.2-fold, promoting cell survival . Methodological insights include:

  • Pathway inhibition assays: Treat LETM2-overexpressing cells with LY294002 (PI3K inhibitor) to reverse anti-apoptotic effects .

  • Co-immunoprecipitation: Identify direct interactions between LETM2 and PI3K regulatory subunits .

  • In vivo xenografts: Compare tumor growth in mice injected with LETM2-knockdown vs. wild-type PDAC cells. LETM2-deficient tumors show 58% smaller volumes (p < 0.001) .

What strategies address challenges in generating recombinant LETM2?

Recombinant LETM2 production faces hurdles like insolubility and misfolding. Optimized protocols involve:

  • Baculovirus expression systems: Use Sf9 insect cells for proper eukaryotic post-translational modifications .

  • Detergent screening: Test n-dodecyl-β-D-maltoside (DDM) for solubilizing LETM2 without denaturation .

  • Size-exclusion chromatography: Validate monodispersity via Superdex 200 profiles .

Table 2: Key parameters for recombinant LETM2 purification

ParameterOptimal conditionOutcome
Expression hostSf9 insect cells80% solubility
Solubilization1.2% DDM + 0.1% CHAPS95% recovery
Buffer pH7.4 (20 mM HEPES)Stable for 72 hours
Storage−80°C with 10% glycerolNo aggregation after thawing
Adapted from .

How to reconcile conflicting data on LETM2’s role in mitophagy?

While LETM1 depletion induces mitophagy via K+ dysregulation , LETM2’s role is less clear. Researchers should:

  • Combine flux assays and TEM: Quantify LC3-II/LC3-I ratios and autophagosome counts in LETM2-knockdown cells .

  • Modulate mitochondrial K+: Use ionophores (e.g., valinomycin) to test if LETM2 loss mimics LETM1’s effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.