Recombinant Mouse Leucine-rich repeat-containing protein 3B (Lrrc3b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Lrrc3b; Lrp15; Leucine-rich repeat-containing protein 3B; Leucine-rich repeat protein 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-259
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lrrc3b
Target Protein Sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Uniprot No.

Target Background

Gene References Into Functions
  1. Odor stimulation of mouse olfactory sensory neurons directly and rapidly increases Lrrc3b expression. [Lrrc3b] PMID: 24692514
Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of Lrrc3b?

Lrrc3b contains interaction motifs of 20 to 29 amino acid residues characterized by repetition of hydrophobic residues, particularly leucine. The protein functions primarily as a tumor suppressor gene with significantly lower expression in various cancer tissues (gastric, renal, colorectal, lung, and breast) compared to adjacent normal tissue . Functionally, Lrrc3b plays essential roles in tumorigenesis inhibition, cancer progression suppression, immunity regulation, hormone-receptor interactions, cell adhesion, signal transduction, gene expression regulation, and apoptosis . The leucine-rich repeat (Lrr) regions serve as important pattern recognition motifs that facilitate protein-protein interactions, particularly in immune system functions .

How is Lrrc3b expression regulated at the molecular level?

Lrrc3b expression is significantly regulated by DNA methylation at its promoter region. Research has established a clear inverse correlation between promoter methylation levels and gene expression . Higher methylation (known as silencing score) corresponds to lower Lrrc3b expression, which has been associated with immune inhibition and activation of cancer-related pathways . This epigenetic control mechanism appears to be a critical determinant of Lrrc3b's tumor suppressive function, with hypermethylation frequently observed in cancerous tissues compared to normal adjacent tissues.

What experimental methods are commonly used to detect and quantify Lrrc3b expression?

Common methodologies for Lrrc3b detection and quantification include:

  • RNA-sequencing analysis: To quantify mRNA expression levels and correlate them with clinical outcomes

  • DNA methylation analysis: Using Illumina methylation array probes mapped to the Lrrc3b gene

  • Immunohistochemistry: For protein localization and expression in tissue samples

  • Mass spectrometry sequencing: For protein identification and characterization

  • Western blotting: Using specific antibodies to detect Lrrc3b from tissue or cell extracts

For methylation analysis specifically, researchers commonly employ the Illumina Human Methylation 450k platform, retaining all matched probes and analyzing differential methylation levels between tumor and normal tissue through Wilcoxon test .

How does Lrrc3b influence the tumor immune microenvironment?

Lrrc3b plays a significant role in modulating the tumor immune microenvironment. Research demonstrates that inactivation of Lrrc3b promotes the enrichment of immunosuppressive cell populations, including:

  • Myeloid-derived suppressor cells (MDSCs)

  • Cancer-associated fibroblasts (CAFs)

  • M2 subtype of tumor-associated macrophages (M2-TAMs)

  • M1 subtype of tumor-associated macrophages (M1-TAMs)

  • Regulatory T (Treg) cells

These changes create an immunosuppressive microenvironment that facilitates tumor evasion of immune surveillance. Additionally, Lrrc3b expression shows significant correlation with immune-related genes, including those encoding major histocompatibility complex (MHC), immune activation factors, and chemokines . This suggests a complex interplay between Lrrc3b expression and anti-tumor immune responses that could be leveraged therapeutically.

What are the challenges in generating functional recombinant mouse Lrrc3b for research applications?

Producing functional recombinant Lrrc3b presents several technical challenges:

  • Protein folding complexity: The leucine-rich repeat domains require precise folding to maintain their recognition function, which can be difficult to achieve in recombinant expression systems

  • Expression system selection: Bacterial expression systems may not provide appropriate post-translational modifications, while mammalian systems often yield lower protein quantities

  • Purification challenges: The hydrophobic nature of the leucine-rich repeats can cause aggregation during purification

  • Functional validation: Confirming that the recombinant protein retains native binding properties and biological activities

Researchers have successfully addressed some of these challenges by creating truncated forms of recombinant Lrrc3b to study specific functional domains. For example, the Lrr region can be isolated experimentally through PCR-amplification of plasmid constructs with specific primers (similar to approaches used for other Lrr proteins) . Expression in E. coli BL21(DE3)pLysS has been successful for related Lrr-containing proteins, suggesting this could be applicable to mouse Lrrc3b as well .

How do Lrrc3b polymorphisms influence cancer susceptibility and progression?

Lrrc3b polymorphisms significantly impact cancer susceptibility and progression through multiple mechanisms. A comprehensive study examining ten single-nucleotide polymorphisms (SNPs) in Lrrc3b found:

  • Reduced cancer risk: The rs1907168 polymorphism was associated with reduced breast cancer risk (heterozygote model, FPRP = 0.184)

  • Tumor characteristics: rs6551122 and rs12635768 variants were associated with smaller tumor size (<2cm) in breast cancer patients

  • Hormone receptor status: rs112276562, rs6551122, and rs73150416 variants contributed to lower incidence of PR-positive breast cancer

  • Proliferation markers: rs6788033 was associated with lower expression of Ki-67

Additionally, SNP-SNP interaction analysis revealed that certain combinations have stronger effects on cancer risk. The best multi-loci model included rs112276562, rs1907168, and rs6551130 (testing accuracy = 0.5205, CVC = 7/10, p<0.0001) .

SNPAssociationStatistical SignificanceModel
rs1907168Reduced BC riskFPRP = 0.184Heterozygote
rs112276562Lower PR+ BCFPRP = 0.095Heterozygote
rs73150416Lower PR+ BCFPRP = 0.159Heterozygote
rs6788033Lower Ki-67OR = 0.68, p = 0.024Log-additive

What are the optimal experimental conditions for studying Lrrc3b-mediated tumor suppression in mouse models?

When designing experiments to study Lrrc3b's tumor suppressive functions in mouse models, researchers should consider:

  • Genetic approaches:

    • Lrrc3b knockout models to observe enhanced tumor development

    • Conditional knockout systems for tissue-specific deletion

    • Overexpression models to assess tumor suppression effects

  • Experimental protocols:

    • Tumor induction through chemical carcinogens or crossing with spontaneous tumor models

    • Monitoring tumor incidence, multiplicity, size, and invasion

    • Analysis of immune cell infiltration in the tumor microenvironment

    • Assessment of epigenetic markers including DNA methylation at the Lrrc3b promoter

  • Assessment metrics:

    • Tumor growth kinetics and metastatic potential

    • Survival analysis using Kaplan-Meier curves

    • Immune profiling of tumor-infiltrating lymphocytes

    • Silencing score based on Lrrc3b promoter methylation

The experimental timeline should allow for complete tumor development, typically 4-6 months depending on the cancer model, with periodic assessment of Lrrc3b expression and methylation status.

How can researchers effectively analyze the relationship between Lrrc3b methylation and immunotherapy response?

To analyze the relationship between Lrrc3b methylation and immunotherapy response, researchers should implement a comprehensive approach:

This methodology has proven valuable in predicting responses to anti-PD-1 therapy in non-small cell lung cancer (NSCLC) and breast cancer (BRCA) .

What are the common pitfalls when analyzing Lrrc3b promoter methylation, and how can they be avoided?

Analysis of Lrrc3b promoter methylation presents several potential challenges:

  • Probe selection issues:

    • Problem: Incomplete coverage of critical CpG sites

    • Solution: Use comprehensive methylation arrays (e.g., Illumina Human Methylation 450k) and validate with bisulfite sequencing for regions of interest

  • Technical variation:

    • Problem: Batch effects in methylation analysis

    • Solution: Include technical replicates and appropriate normalization methods; perform batch correction during data analysis

  • Biological interpretation:

    • Problem: Difficulty distinguishing driver from passenger methylation changes

    • Solution: Correlate methylation with gene expression data and functional outcomes; focus on differential methylation between matched tumor-normal pairs

  • Silencing score calculation:

    • Problem: Selection of inappropriate CpG sites for model construction

    • Solution: Select probes exhibiting significant differential methylation (p<0.05) for each cancer type when constructing the silencing score

  • Threshold determination:

    • Problem: Arbitrary cutoffs for high/low methylation

    • Solution: Use data-driven approaches such as X-tile to determine optimal cut-off values for each cancer type

How can contradictory data regarding Lrrc3b function in different experimental systems be reconciled?

When faced with contradictory results regarding Lrrc3b function across different experimental systems, researchers should:

  • Systematically compare experimental conditions:

    • Cell/tissue types used (cancer vs. normal, tissue of origin)

    • Expression systems (transient vs. stable, overexpression vs. knockdown)

    • Species differences (mouse vs. human Lrrc3b)

  • Analyze context-dependent effects:

    • Evaluate the tumor microenvironment in different models

    • Assess baseline immune activation status

    • Consider genetic background and additional mutations

  • Employ multiple methodological approaches:

    • Combine in vitro, in vivo, and ex vivo systems

    • Use both gain-of-function and loss-of-function approaches

    • Validate with clinical samples from multiple cohorts

  • Investigate regulatory mechanisms:

    • Analyze promoter methylation status across experimental systems

    • Examine post-transcriptional and post-translational modifications

    • Consider protein-protein interactions that may differ between systems

  • Meta-analysis approach:

    • Pool data from multiple studies with similar methodologies

    • Apply statistical corrections for inter-study variation

    • Identify consistent patterns across diverse experimental conditions

How can Lrrc3b be utilized as a biomarker for immunotherapy response prediction?

Lrrc3b shows significant potential as a biomarker for immunotherapy response prediction through the following approaches:

  • Methylation-based predictive model:

    • Develop a silencing score based on Lrrc3b promoter methylation

    • Higher scores correlate with immune inhibition and poor response to immunotherapy

    • This model can be applied specifically to predict anti-PD-1 therapy response in NSCLC and BRCA patients

  • Expression level assessment:

    • Quantify Lrrc3b mRNA or protein expression in pre-treatment biopsies

    • Lower expression levels indicate immunosuppressive tumor microenvironment

    • Combine with immune cell profiling for enhanced predictive power

  • Implementation strategy:

    • Pre-treatment biopsy analysis using methylation arrays or targeted bisulfite sequencing

    • Calculation of patient-specific silencing scores

    • Integration with other biomarkers (PD-L1 expression, tumor mutational burden)

    • Stratification of patients into likely responders vs. non-responders

  • Validation requirements:

    • Prospective clinical trials incorporating Lrrc3b methylation analysis

    • Comparison with standard-of-care biomarkers

    • Assessment of predictive value across multiple cancer types

This approach leverages the observed relationship between Lrrc3b status and the anti-tumor immune microenvironment to predict which patients will most likely benefit from immunotherapy interventions.

What genetic engineering approaches can be used to manipulate Lrrc3b expression for therapeutic purposes?

Several genetic engineering strategies can be employed to modulate Lrrc3b expression for potential therapeutic applications:

  • CRISPR/Cas9-based approaches:

    • Promoter demethylation: Using catalytically dead Cas9 (dCas9) fused to TET demethylase to reverse Lrrc3b promoter hypermethylation

    • Gene activation: dCas9-activator systems targeted to the Lrrc3b promoter to enhance expression

    • Mutation correction: Repair of deleterious Lrrc3b polymorphisms associated with increased cancer risk

  • RNA-based therapeutics:

    • mRNA delivery: Synthetic Lrrc3b mRNA encapsulated in lipid nanoparticles

    • miRNA inhibitors: Antagonists of miRNAs that downregulate Lrrc3b expression

    • Antisense oligonucleotides: To modulate Lrrc3b splicing or expression

  • Viral vector delivery systems:

    • Adeno-associated virus (AAV): For tissue-specific Lrrc3b gene delivery

    • Lentiviral vectors: For stable integration and expression in dividing cells

    • Oncolytic viruses: Engineered to selectively replicate in cancer cells while delivering Lrrc3b

  • Combination approaches:

    • Lrrc3b restoration therapy combined with immune checkpoint inhibitors

    • Epigenetic drugs (DNMT inhibitors) to reverse Lrrc3b promoter methylation, followed by immunotherapy

Each approach requires careful consideration of delivery methods, tissue specificity, and potential off-target effects to maximize therapeutic benefit while minimizing toxicity.

What are the most promising areas for future research on Lrrc3b in cancer immunotherapy?

The intersection of Lrrc3b biology and cancer immunotherapy presents several promising research directions:

  • Mechanistic studies:

    • Detailed investigation of how Lrrc3b modulates specific immune cell populations

    • Identification of direct protein-protein interactions between Lrrc3b and immune receptors

    • Characterization of downstream signaling pathways influenced by Lrrc3b expression

  • Combination therapies:

    • Evaluation of Lrrc3b restoration combined with various immunotherapy approaches

    • Testing epigenetic drugs that target Lrrc3b methylation as immunotherapy sensitizers

    • Development of dual-action therapeutics that both restore Lrrc3b function and enhance immune activation

  • Biomarker development:

    • Refinement of the Lrrc3b methylation silencing score for different cancer types

    • Integration with multi-omic predictive models for immunotherapy response

    • Development of liquid biopsy approaches to monitor Lrrc3b methylation non-invasively

  • Expanded cancer applications:

    • Extension of Lrrc3b research beyond NSCLC and breast cancer to other immunotherapy-responsive cancers

    • Investigation of cancer type-specific functions of Lrrc3b

    • Comparative analysis across cancer types to identify common mechanisms

These research avenues could significantly advance our understanding of Lrrc3b's role in cancer immunity and lead to improved immunotherapeutic strategies.

How might studies of Lrrc3b polymorphisms inform personalized cancer treatment strategies?

Lrrc3b polymorphism studies offer valuable insights for personalized cancer treatment approaches:

  • Risk stratification:

    • Genotyping of key Lrrc3b SNPs (e.g., rs1907168, rs112276562, rs73150416) to identify patients at lower or higher cancer risk

    • Development of polygenic risk scores incorporating Lrrc3b variants

    • Integration with other genetic and environmental risk factors

  • Treatment selection:

    • Correlation of specific polymorphisms with treatment response patterns

    • Identification of variants associated with immunotherapy sensitivity

    • Selection of targeted therapies based on pathway alterations associated with specific Lrrc3b variants

  • Monitoring strategies:

    • Tailored surveillance protocols based on Lrrc3b polymorphism status

    • More frequent monitoring for patients with high-risk variants

    • Integration with other biomarkers for comprehensive risk assessment

  • SNP-SNP interaction models:

    • Implementation of multi-loci prediction models (e.g., rs112276562, rs1907168, and rs6551130) for more accurate risk and response prediction

    • Development of clinical decision support tools incorporating these models

    • Validation in prospective clinical cohorts

This knowledge can help clinicians develop more personalized approaches to cancer prevention, early detection, and treatment selection based on individual genetic profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.