Recombinant Mouse Leucine-rich repeat-containing protein 3 (Lrrc3)

Shipped with Ice Packs
In Stock

Description

General Information

Lrrc3 in rats is impacted by several compounds. Benzo(a)pyrene decreases the expression of Lrrc3 mRNA, while other compounds such as perfluorohexanesulfonic acid and propanal increase Lrrc3 expression .

Basic Information of Lrrc3

PropertyDescription
NameLeucine-rich repeat-containing protein 3
FunctionImportant for defense against pathogens, cleaves and activates sterol regulatory element binding proteins (SREBPs), and can promote apoptosis
Predicted LocationMembrane, plasma membrane

Function and Interactions

Lrrc3 is important for defense against pathogens . It cleaves and activates sterol regulatory element binding proteins (SREBPs) and can promote apoptosis . Lrrc3 interacts with several proteins, including:

  • Caspase-1 subunit p10 (CASP1)

  • Apoptosis-associated speck-like protein containing a CARD (PYCARD)

  • NACHT, LRR and PYD domains-containing protein 3 (NLRP3)

  • Adhesion G protein-coupled receptor L2 (ADGRL2)

  • Adhesion G protein-coupled receptor L1 (ADGRL1)

  • Adhesion G protein-coupled receptor L3 (ADGRL3)

These interactions suggest that Lrrc3 plays a role in inflammatory processes and immune responses .

Role in NLRP3 Inflammasome Activation

The leucine-rich repeat (LRR) domain of NLRP3 is required for NLRP3 inflammasome activation in macrophages . Studies using CRISPR-Cas9 gene-editing have demonstrated that macrophages expressing an NLRP3 mutant lacking the LRR domain show reduced high-molecular-mass NLRP3 complexes after stimulation .

Impact of Benzo(a)pyrene on LRRC3 Expression

Exposure to benzo(a)pyrene results in decreased expression of LRRC3 mRNA in rats . Benzo(a)pyrene can also affect the methylation of LRRC3 in humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
Lrrc3; Leucine-rich repeat-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-257
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lrrc3
Target Protein Sequence
CPQACQCPDHAGAVAVHCSSRGLQEIPRDIPADTVLLKLDANRISRVPNGAFQHLPQLRE LDLSHNAIEAIGPAAFSGLAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQVLDSGASFCSTHRKTTDVAMLVTMF GWFTMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPVSKEPLSPVP
Uniprot No.

Target Background

Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of Mouse Lrrc3 protein?

Mouse Leucine-rich repeat-containing protein 3 (Lrrc3) is a 25 kDa member of the leucine-rich repeat protein superfamily. The protein is approximately 225 amino acids in length, containing three leucine-rich repeats (LRRs) located at specific regions within the protein structure . These LRRs typically form curved, solenoid structures that provide surfaces for protein-protein interactions.

For experimental studies involving recombinant Lrrc3, researchers should note the following specifications:

ParameterSpecifications
Amino Acid SequenceCPQACQCPDHAGAVAVHCSSRGLQEIPRDIPADTVLLKLDANRISRVPNGAFQHLPQLRELDLSHNAIEAIGPAAFSGLAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACSHTSAQEQFVGKPLIQVLDSGAS...
Common TagsC-terminal 6-His tag
Predicted Molecular Weight25 kDa
Storage RecommendationsStore at -20°C; for extended storage, conserve at -80°C; avoid repeated freeze-thaw cycles

For structural studies, consider that the protein contains multiple conserved domains that may affect its folding properties and interaction capabilities when produced as a recombinant protein.

How should researchers prepare and reconstitute Recombinant Mouse Lrrc3 for experimental use?

Proper reconstitution of recombinant proteins is crucial for maintaining biological activity. For Mouse Lrrc3:

  • Initial preparation: Centrifuge the vial before opening to ensure all material is at the bottom of the tube.

  • Reconstitution method:

    • For lyophilized preparations, reconstitute at 100 μg/mL in an appropriate buffer (PBS is commonly used)

    • Add the solution gently down the sides of the vial rather than directly onto the lyophilized cake

    • Allow several minutes for complete reconstitution; avoid vortexing as this can denature the protein

  • Working solution preparation:

    • For long-term storage, dilute to working aliquots in a 0.1% BSA solution

    • Store these aliquots at -80°C to maintain protein stability

  • Carrier considerations:

    • Some recombinant proteins are available in carrier-free (CF) formulations, which lack BSA

    • CF versions are recommended for applications where BSA might interfere with experimental outcomes

For optimal experimental results, allow the protein to reach room temperature before use and always prepare fresh dilutions on the day of experimentation.

What are the validated detection methods for Mouse Lrrc3 in biological samples?

Several validated methods exist for detecting Mouse Lrrc3 in research samples:

  • ELISA (Enzyme-Linked Immunosorbent Assay):

    • Standard detection range: 0.156-10 ng/mL

    • Sensitivity: Approximately 0.068 ng/mL

    • Sample types: Tissue homogenates, cell lysates, and other biological fluids

    • Principle: Double-antibody sandwich assay using antibodies specific to Lrrc3

  • Western Blotting:

    • Recommended dilution of primary antibodies: Determined empirically, typically 1:1000-1:5000

    • Expected band size: Approximately 25 kDa

    • Reducing conditions recommended

  • Immunohistochemistry/Immunofluorescence:

    • Fixation preferences: 4% paraformaldehyde followed by permeabilization

    • Antigen retrieval may be required for formalin-fixed tissues

For quantitative analysis, consider the following quality control parameters from a commercial ELISA kit:

ParameterDetails
Intra-assay PrecisionCV < 8% (samples tested 20 times on one plate)
Inter-assay PrecisionCV < 10% (samples tested on 3 different plates)
Recovery Rate85-105% in biological matrices
Test Range0.156-10 ng/mL

When selecting a detection method, consider the experimental question, sample type, and required sensitivity.

How does Lrrc3 function differ from other Leucine-rich repeat family members in neuronal contexts?

Leucine-rich repeat proteins play diverse roles in neuronal development and function. While less is known specifically about Lrrc3 compared to other family members, methodological approaches to investigate its unique functions include:

  • Comparative expression analysis:

    • Unlike LRRTM3, which shows strong prenatal expression in neural progenitors of the anterior neural plate and developing forebrain , Lrrc3 shows a more widespread expression pattern

    • RT-qPCR comparison of expression levels across developmental stages can reveal temporal regulation differences

    • Single-cell RNA sequencing can identify cell-type specific expression patterns

  • Functional differentiation through domain analysis:

    • While LRRTM3 has a transmembrane domain and interacts with postsynaptic density proteins through its PDZ-binding motif (ECEV) , Lrrc3's unique structural features suggest different interaction partners

    • Domain swapping experiments between Lrrc3 and other LRR family members can identify functionally critical regions

  • Signaling pathway involvement:

    • Unlike NLRR-3, which amplifies MAPK activation by epidermal growth factor (EGF) , Lrrc3's role in signaling remains to be fully characterized

    • Phosphoproteomic analysis following Lrrc3 overexpression or knockdown can reveal affected signaling pathways

Methodological approach for comparative analysis:

  • Generate expression vectors containing Lrrc3 and other LRR family members (LRRTM3, NLRR-3)

  • Conduct side-by-side transfection experiments in relevant cell lines (neuronal or glial)

  • Analyze effects on downstream signaling using phospho-specific antibodies

  • Perform co-immunoprecipitation to identify differential binding partners

What are the optimal experimental conditions for studying Lrrc3 protein-protein interactions?

Investigating Lrrc3 protein-protein interactions requires careful consideration of experimental conditions:

  • Co-immunoprecipitation (Co-IP) approaches:

    • Buffer composition: Use buffers containing 150 mM NaCl, 1% NP-40 or Triton X-100, 50 mM Tris-HCl (pH 7.4)

    • Include protease and phosphatase inhibitors to preserve interaction integrity

    • Crosslinking with 1-2% formaldehyde can stabilize transient interactions

    • Gentle lysis conditions to maintain native protein conformations

  • Pull-down assays with recombinant proteins:

    • Utilize His-tagged recombinant Mouse Lrrc3 as bait protein

    • Pre-clear lysates with appropriate control beads to reduce non-specific binding

    • Include negative controls (unrelated His-tagged protein) to identify specific interactions

    • Consider using varying salt concentrations (150-500 mM NaCl) to determine interaction strength

  • Proximity-based approaches:

    • BioID or TurboID fusion proteins can identify proximal proteins in living cells

    • FRET or BRET assays can detect direct interactions and provide spatial information

Methodological workflow for pull-down experiments:

  • Immobilize purified His-tagged Lrrc3 on Ni-NTA or cobalt resin

  • Incubate with pre-cleared cell lysates from relevant mouse tissues/cells

  • Wash stringently to remove non-specific binders

  • Elute and analyze binding partners by mass spectrometry

Given the limited information on Lrrc3's natural interaction partners, an unbiased proteomic approach is recommended as an initial screen before targeted validation of specific interactions.

How can researchers effectively design knockout or knockdown experiments for Mouse Lrrc3?

Designing effective gene modification strategies for Mouse Lrrc3 requires careful consideration of the gene structure and experimental goals:

  • CRISPR/Cas9 knockout design:

    • Target early exons to ensure complete loss of function

    • Design multiple guide RNAs (gRNAs) targeting different exons to improve efficiency

    • Validate knockout by sequencing, Western blot, and RT-qPCR

    • Consider potential splice variants when designing targeting strategies

  • RNAi-based knockdown approaches:

    • Design siRNAs or shRNAs targeting conserved regions of the transcript

    • Test multiple sequences for knockdown efficiency

    • Use scrambled sequences as negative controls

    • Monitor knockdown efficiency using RT-qPCR and Western blot

  • Conditional knockout strategies:

    • Use Cre-loxP system for tissue-specific or inducible knockouts

    • Consider timing of knockout induction based on developmental expression patterns

Recommended target sequences for CRISPR/Cas9 should be designed using appropriate software tools and validated experimentally. For RNAi, consider sequences that target all known splice variants.

For phenotypic analysis, assess multiple cellular parameters including morphology, proliferation, migration, and specific functional assays relevant to the tissue or cell type being studied.

What methodological approaches can address the challenges in producing high-quality recombinant Mouse Lrrc3?

Production of high-quality recombinant Mouse Lrrc3 presents several challenges that researchers should address methodically:

  • Expression system selection:

    • Bacterial systems (E. coli) may not provide proper folding or post-translational modifications

    • Mammalian expression systems (HEK293, CHO cells) better preserve native structure but yield lower protein amounts

    • Insect cell systems (Sf9, High Five) offer a compromise between yield and proper folding

  • Protein solubility enhancement:

    • Fusion tags: Consider MBP, SUMO, or thioredoxin tags to improve solubility

    • Codon optimization for the expression host

    • Lower induction temperature (16-18°C) for bacterial expression systems

    • Co-expression with chaperones may improve folding

  • Purification strategy optimization:

    • Two-step purification recommended: affinity chromatography followed by size exclusion

    • Buffer optimization to maintain protein stability

    • Consider addition of glycerol (10%) to prevent aggregation

Experimental approach for comparing expression systems:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coliFast growth, high yield, economicalLacks post-translational modifications, potential inclusion bodies5-50 mg/L
Mammalian cellsNative-like protein folding and modificationsExpensive, lower yield, longer production time0.5-5 mg/L
Insect cellsHigher yield than mammalian, some PTMsMore complex than bacteria, less PTMs than mammalian2-10 mg/L

For challenging proteins like Lrrc3, expression screening in multiple systems is recommended to identify optimal conditions before scaling up production.

How can researchers investigate the potential role of Lrrc3 in neurological disorders based on its structural similarity to LRRTM3?

Given the structural similarities between Lrrc3 and LRRTM3, which has been implicated in neurological disorders, researchers can employ several methodological approaches:

  • Association studies in disease models:

    • Analyze Lrrc3 expression in mouse models of neurological disorders

    • Perform comparative transcriptomics/proteomics in affected vs. normal tissues

    • Use conditional Lrrc3 knockout in specific brain regions to assess behavioral phenotypes

  • Molecular pathway analysis:

    • LRRTM3 has been shown to influence BACE1 cleavage of APP, generating Aβ and C99 fragments

    • Investigate whether Lrrc3 affects similar pathways using:

      • Co-expression studies with BACE1 and APP

      • Analysis of Aβ production in Lrrc3-overexpressing or knockout cells

      • Protein-protein interaction studies with components of the amyloid processing pathway

  • Electrophysiological studies:

    • Assess synaptic function in neurons with altered Lrrc3 expression

    • Compare results with known effects of other LRR family proteins

Experimental approach for investigating APP processing:

  • Transfect neuronal cells with Lrrc3 expression vectors

  • Measure APP processing products using Western blot and ELISA

  • Analyze changes in BACE1 activity using fluorogenic substrates

  • Compare effects with those of known modulators (e.g., LRRTM3)

Given that LRRTM3 is influenced by STOX1 and subsequently induces BACE1 cleavage of APP , investigating similar regulatory mechanisms for Lrrc3 could provide valuable insights into its potential role in neurological disorders.

What are the critical considerations for designing cross-species comparative studies of Lrrc3 function?

Cross-species comparative studies of Lrrc3 can provide valuable evolutionary and functional insights, but require careful methodological considerations:

  • Sequence homology analysis:

    • Human LRRC3 shares 83% amino acid identity with mouse Lrrc3 over amino acids 33-204

    • Perform multiple sequence alignment of Lrrc3 from different species to identify conserved domains

    • Focus functional studies on highly conserved regions with presumed evolutionary importance

  • Expression pattern comparison:

    • Use RNA-seq data from homologous tissues across species

    • Compare cellular localization using species-specific antibodies or tagged constructs

    • Analyze promoter regions for conserved regulatory elements

  • Functional conservation testing:

    • Express Lrrc3 from different species in null backgrounds

    • Assess rescue of phenotypes to determine functional equivalence

    • Use domain swapping between species to identify functionally divergent regions

When designing cross-species experiments, consider these practical aspects:

  • Select antibodies that recognize conserved epitopes for cross-species detection

  • Use species-specific positive controls in all experiments

  • Account for differences in expression levels when comparing functional outcomes

Recommended workflow for cross-species comparison:

  • Perform bioinformatic analysis of sequence conservation

  • Generate expression constructs for Lrrc3 from multiple species

  • Conduct parallel functional assays in appropriate cell models

  • Validate key findings in primary cells from each species

How should researchers interpret contradictory data regarding Lrrc3 function across different experimental systems?

When confronting contradictory results regarding Lrrc3 function, a systematic approach can help resolve discrepancies:

  • Experimental system differences analysis:

    • Compare cell types used (primary cells vs. cell lines, different tissue origins)

    • Evaluate expression levels of Lrrc3 and potential interacting partners

    • Analyze differences in post-translational modifications across systems

    • Consider developmental stage differences if applicable

  • Methodological reconciliation approach:

    • Standardize protein preparation methods across experiments

    • Use multiple detection techniques to verify results (e.g., both overexpression and knockdown)

    • Perform dose-response experiments to identify threshold effects

    • Consider temporal factors that might affect outcomes

  • Contextual interpretation framework:

    • Different outcomes may reflect genuine biological context-dependency

    • Design experiments to specifically test context-dependency hypotheses

    • Consider the possibility of redundant mechanisms or compensatory pathways

A systematic approach to resolving contradictions would include:

StepMethodologyExpected Outcome
1. Reproduce contradictory resultsReplicate published protocols exactlyConfirmation of discrepancy
2. Identify key variablesSystematically alter experimental conditionsIdentification of critical factors
3. Test reconciliation hypothesesDesign experiments that bridge different systemsUnified model or defined contexts
4. Validate in physiologically relevant modelsTest in primary cells or in vivoDetermination of physiological relevance

When publishing results, transparently report all experimental conditions and acknowledge limitations of each system to facilitate interpretation by the broader research community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.