Recombinant Mouse Leucine-rich repeat-containing protein 4B (Lrrc4b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Lrrc4b; Lrig4; Leucine-rich repeat-containing protein 4B; Netrin-G3 ligand; NGL-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-574
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Lrrc4b
Target Protein Sequence
GGGGVAVTSAAGGGSPPATSCP AACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLS KNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAF NRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSG NRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFT PLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSH FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHD GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGPGGGGPGGGGGAGGA GGYTYFTTVTVETLETQPGEEAQQPRGTEKEPPGPTTDGAWGGGRPDAAAPASASTTAPA PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTK
Uniprot No.

Target Background

Function
Leucine-rich repeat-containing protein 4B (LRRC4B) is a synaptic adhesion protein that regulates the formation of excitatory synapses. Bidirectional trans-synaptic adhesion between LRRC4B and protein tyrosine phosphatase, receptor type F (PTPRF) is crucial for excitatory synapse formation.
Gene References Into Functions
  1. NGL-3-induced differentiation of hippocampal mossy fibers is dependent on afadin, but not the afadin-binding presynaptic nectin-1. PMID: 28695613
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Cell junction, synapse, presynaptic cell membrane.

Q&A

What is mouse Lrrc4b and how is it structurally characterized?

Leucine-rich repeat-containing protein 4B (Lrrc4b) is a member of the larger LRR protein family. Like other LRR proteins, Lrrc4b contains characteristic leucine-rich repeat domains, which are structural motifs that form alpha/beta horseshoe folds with parallel beta sheets on the concave side and helical elements on the convex side. These domains typically mediate protein-protein interactions.

Structurally, Lrrc4b contains multiple LRR motifs that follow the general LRR consensus sequence pattern. Analysis of LRR proteins shows they can be clustered based on sequence similarity of their LRR domains, with classification methods including hierarchical clustering algorithms to determine relationships between different LRR-containing proteins . Recombinant mouse Lrrc4b is often produced with various tags (such as His, Fc, or Avi tags) to facilitate purification and experimental applications .

What are the general functions of LRR domain-containing proteins in neural systems?

LRR-containing proteins serve crucial roles in neural development and function. They participate in:

  • Cell surface interaction networks essential for neural recognition events

  • Formation of complex cellular neural networks during development

  • Mediation of low-affinity extracellular interactions between neural receptors

Studies have revealed that LRR proteins like Lrrc4b are part of a network of 34 cell surface receptor-ligand pairs involved in neural cellular recognition events . These proteins often act as receptors or co-receptors in signaling pathways critical for neural development.

Related family members like LRRC4 have been implicated in hippocampal memory function, specifically in mediating NMDAR-dependent synaptic plasticity by binding to NMDAR subunits (GluN1, GluN2A, and GluN2B) . This suggests Lrrc4b might have similar functions in synaptic development and plasticity.

How are recombinant mouse Lrrc4b proteins typically produced for research applications?

Recombinant mouse Lrrc4b is typically produced in mammalian expression systems, most commonly HEK293 cells, which allow for proper protein folding and post-translational modifications essential for the function of complex proteins like Lrrc4b . The production process generally follows these steps:

  • Gene cloning into appropriate expression vectors with desired tags (His, Fc, Avi)

  • Transfection into HEK293 cells

  • Protein expression under optimized conditions

  • Purification using affinity chromatography targeting the fusion tags

  • Quality control including SDS-PAGE for purity assessment (≥85%)

  • Endotoxin testing (<1.0 EU per μg)

  • Storage in PBS buffer with appropriate aliquoting to avoid freeze-thaw cycles

The resulting recombinant protein is stable for at least 6 months when properly stored at -20°C to -80°C . Researchers should verify protein identity through western blotting and functionality through appropriate binding assays.

What expression patterns does Lrrc4b exhibit in mouse neural tissues?

While specific expression data for Lrrc4b is limited in the provided search results, research on LRR proteins generally indicates that paired spatiotemporal gene expression patterns can reveal dynamic neural receptor recognition maps within the developing nervous system .

LRR proteins often show distinct expression patterns during neural development that correlate with their functions. For instance, related LRR proteins are known to participate in:

  • Formation of neural circuits during embryonic development

  • Synaptic development in postnatal brain

  • Region-specific expression in brain areas like the hippocampus and cerebral cortex

Understanding the precise expression pattern of Lrrc4b requires techniques such as in situ hybridization, immunohistochemistry on brain sections at different developmental stages, and quantitative PCR to analyze tissue-specific expression levels.

How does Lrrc4b relate to other LRR family proteins in terms of classification?

LRR proteins, including Lrrc4b, can be classified based on several characteristics:

  • The number and arrangement of LRR domains

  • The presence or absence of transmembrane (TM) regions

  • Additional non-LRR domains present in the protein

Bioinformatic analyses of human LRR proteins have revealed several distinct classes (S, T, RI, CC, and S+T) with specific structural and functional characteristics . Some LRR proteins contain transmembrane regions, particularly those in the T and S+T categories, while others are soluble. Additionally, LRR proteins are often distinguished by accompanying domains, such as F-box domains (in CC category) or NACHT NTPase domains (in RI category) .

To determine where Lrrc4b fits within this classification system, researchers employ specialized hidden Markov models (HMMs) to identify LRR arrangements and class assignments based on sequence similarity scoring .

What methodological approaches are most effective for studying Lrrc4b interactions?

Investigating Lrrc4b interactions requires a combination of techniques:

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation using tagged recombinant Lrrc4b

    • Pull-down assays with purified Lrrc4b as bait

    • Surface plasmon resonance for quantitative binding kinetics

    • Proximity ligation assays for detecting interactions in situ

  • Large-Scale Screening Approaches:

    • Extracellular protein interaction screens with Lrrc4b ectodomain

    • Systematic screening against libraries of neural receptor proteins

Research on related LRR proteins has utilized interaction screens capable of detecting low-affinity extracellular interactions, particularly important for neural recognition events . For example, systematic interaction screens have successfully identified binding partners for orphan receptor families like Lrrtms and Lrrns.

  • Functional Validation:

    • Cell aggregation assays to confirm interaction between cells expressing Lrrc4b and its partners

    • Cell-based reporter assays to detect downstream signaling activation

    • CRISPR-Cas9 gene editing to validate functional relevance of interactions

Quantitative biochemical analysis of interactions should examine receptor binding strengths, as studies on related receptors (e.g., Unc5b and Flrt) have revealed surprising quantitative variations in binding affinities .

How might Lrrc4b contribute to neural circuit development?

Based on studies of related LRR proteins, Lrrc4b likely contributes to neural circuit development through several mechanisms:

  • Synaptic Development:
    LRRC4 has been shown to mediate the formation of Schaffer collateral synapses in the hippocampus . By analogy, Lrrc4b may be involved in forming specific synaptic connections in different brain regions.

  • Axon Guidance and Pathfinding:
    LRR proteins often function as axon guidance molecules. Lrrc4b may interact with other neural recognition molecules to guide axons to their correct targets during development.

  • Synapse Maturation and Plasticity:
    LRRC4 mediates NMDAR-dependent synaptic plasticity (LTP) through interactions with NMDAR subunits . Lrrc4b might play similar roles in modulating synaptic strength and plasticity.

  • Cell Adhesion:
    As a potential cell surface protein, Lrrc4b likely mediates adhesive interactions between neurons or between neurons and glia.

To investigate these functions, researchers should consider:

  • Creating conditional knockout mouse models to examine effects of Lrrc4b deletion on neural development

  • Using time-lapse imaging to track axon growth and synapse formation in Lrrc4b-deficient neurons

  • Employing electrophysiological recordings to assess effects on synaptic transmission and plasticity

  • Analyzing behavioral outcomes in Lrrc4b-deficient animals

What experimental challenges must be addressed when working with recombinant Lrrc4b?

Researchers working with recombinant Lrrc4b should be aware of several technical challenges:

  • Protein Stability and Storage:

    • Recombinant Lrrc4b requires proper storage at -20°C to -80°C

    • Repeated freeze-thaw cycles should be avoided to maintain functionality

    • Aliquoting upon receipt is recommended to preserve stability

  • Protein Purity Considerations:

    • Verify purity by SDS-PAGE (should be ≥85%)

    • Check for endotoxin contamination (<1.0 EU per μg)

    • Validate identity via western blotting with specific antibodies

  • Functional Validation:

    • Ensure proper folding of recombinant protein through circular dichroism analysis

    • Confirm biological activity through binding assays with known or predicted partners

    • Consider potential effects of fusion tags on protein function

  • Solubility and Aggregation:

    • LRR proteins can be prone to aggregation due to their repetitive structure

    • Optimize buffer conditions (pH, salt concentration) to maintain solubility

    • Consider using stabilizing agents if necessary

  • Experimental Controls:

    • Include recombinant proteins with mutated LRR domains as negative controls

    • Use related LRR family proteins to assess specificity of observed interactions

    • Include tag-only controls to rule out tag-mediated effects

How does Lrrc4b signaling compare to other LRR family members like LRRC4?

While specific information about Lrrc4b signaling is limited in the search results, comparison with related proteins provides insights:

FeatureLRRC4LGR4Potential Lrrc4b Function
Signaling PathwayNF-κB activation via PDPK1 binding UnknownMay involve similar downstream mediators
Biological RoleInhibits tumor-infiltrating Treg cells in GBM Promotes prostate cancer EMT and metastasis Potential role in immune modulation or cellular differentiation
Binding PartnersPDPK1, HSP90 UnknownMay interact with signaling adaptors or scaffold proteins
Cellular LocalizationCell surfaceCell surfaceLikely cell surface with potential transmembrane domain

LRRC4 has been shown to directly bind phosphoinositide-dependent protein kinase 1 (PDPK1), leading to IKKβser181 phosphorylation and NF-κB activation, ultimately promoting cytokine secretion . Whether Lrrc4b shares this signaling mechanism requires experimental validation.

Additionally, LRRC4 is involved in hippocampal memory function through formation of Schaffer collateral synapses and mediation of NMDAR-dependent synaptic plasticity . Lrrc4b may have complementary or distinct roles in different neural circuits.

What approaches can be used to study Lrrc4b in the context of neurological disorders?

To investigate potential roles of Lrrc4b in neurological disorders, researchers should consider:

  • Gene Expression Analysis:

    • Compare Lrrc4b expression levels in postmortem brain tissues from patients with neurological disorders versus controls

    • Analyze single-cell RNA sequencing data to identify cell type-specific expression changes in disease states

    • Examine potential correlations between Lrrc4b expression and disease markers

  • Genetic Association Studies:

    • Screen for Lrrc4b variants in patient populations with relevant neurological conditions

    • Assess whether identified variants affect protein function through in vitro assays

    • Create knock-in mouse models expressing disease-associated variants

  • Animal Models:

    • Generate conditional Lrrc4b knockout mice and assess relevant behavioral phenotypes

    • Investigate effects on synapse formation, neural circuit development, and synaptic plasticity

    • Test whether Lrrc4b deletion affects susceptibility to induced neurological conditions

  • Molecular Mechanisms:

    • Determine if Lrrc4b, like LRRC4, interacts with NMDA receptor subunits and affects synaptic plasticity

    • Investigate whether Lrrc4b modulates immune responses in the CNS like LRRC4 does in GBM

    • Explore potential roles in cytokine signaling and neuroinflammation

What methodological approaches can be used to identify the complete interactome of Lrrc4b?

Identifying the complete interactome of Lrrc4b requires multiple complementary approaches:

  • Proximity-Dependent Biotinylation (BioID or TurboID):

    • Fuse Lrrc4b to a biotin ligase to label proximal proteins in living cells

    • Isolate biotinylated proteins and identify by mass spectrometry

    • Compare results from different cellular compartments or developmental stages

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Use recombinant Lrrc4b as bait to pull down interacting proteins

    • Implement crosslinking approaches to capture transient interactions

    • Employ quantitative proteomics (SILAC or TMT) for comparative analysis

  • Protein Microarrays:

    • Screen recombinant Lrrc4b against arrays of extracellular or transmembrane proteins

    • Focus on neural proteins that might participate in recognition events

    • This approach has successfully identified extracellular binding partners for orphan receptor families

  • In Silico Prediction and Validation:

    • Use computational approaches to predict Lrrc4b interactions based on structural similarities to other LRR proteins

    • Apply methods similar to those used for general LRR protein classification

    • Validate top predictions experimentally

  • Functional Genomics Screening:

    • Perform CRISPR screens to identify genes that modify Lrrc4b-dependent phenotypes

    • Use cell-based assays with readouts relevant to neural development

    • Integrate results with interactome data to build functional networks

Integration of these datasets will provide a comprehensive view of the Lrrc4b interactome across different cellular contexts and developmental stages.

How might post-translational modifications regulate Lrrc4b function?

Post-translational modifications (PTMs) likely play crucial roles in regulating Lrrc4b function:

  • Glycosylation:

    • LRR proteins often contain N-linked glycosylation sites that affect protein folding and interaction

    • Expression in HEK293 cells allows for mammalian-type glycosylation of recombinant Lrrc4b

    • Glycosylation patterns may differ between developmental stages or disease states

    • Experimental approach: Compare glycosylation profiles using glycoproteomics and assess functional consequences

  • Phosphorylation:

    • LRRC4 interacts with PDPK1 and affects phosphorylation of downstream targets

    • Lrrc4b may itself be phosphorylated to regulate its activity or interactions

    • Experimental approach: Phosphoproteomic analysis of Lrrc4b under different conditions; site-directed mutagenesis of potential phosphorylation sites

  • Proteolytic Processing:

    • Many cell surface receptors undergo proteolytic processing to regulate activity

    • Ectodomain shedding could generate soluble Lrrc4b fragments with distinct functions

    • Experimental approach: Western blot analysis of Lrrc4b in tissue lysates; mass spectrometry to identify cleavage sites

  • Ubiquitination/SUMOylation:

    • These modifications could regulate Lrrc4b turnover or subcellular localization

    • Experimental approach: Immunoprecipitation followed by ubiquitin/SUMO-specific western blotting; proteasome inhibitor studies

  • Disulfide Bond Formation:

    • Proper folding of LRR domains often depends on disulfide bonds

    • Experimental approach: Analysis of Lrrc4b structure under reducing versus non-reducing conditions

Investigating these PTMs would provide insights into how Lrrc4b activity is dynamically regulated during neural development and in response to various stimuli.

What are the implications of Lrrc4b in modulating immune responses in the nervous system?

Based on the functions of related LRR proteins, Lrrc4b may have significant roles in neuroimmune interactions:

  • Potential Parallels with LRRC4:

    • LRRC4 inhibits tumor-infiltrating regulatory T cells (Ti-Treg) in GBM by promoting cytokine secretion

    • LRRC4 enhances chemotaxis of CD4+CCR4+ T cells in the tumor microenvironment

    • LRRC4 facilitates NF-κB activation and promotes secretion of IL-6, CCL2, and IFN-gamma

  • Neuroimmune Communication:

    • Lrrc4b might mediate interactions between neurons and microglia or infiltrating immune cells

    • It could regulate cytokine production by neural cells in response to injury or infection

    • Expression on specific neural populations might create immunological microenvironments

  • Pathogen Recognition:

    • LRR domains are involved in innate immune sensing and detection of pathogen-associated molecular patterns

    • Lrrc4b might participate in pathogen recognition in the CNS

  • Experimental Approaches:

    • Co-culture systems with neurons expressing Lrrc4b and various immune cell populations

    • Analysis of microglial activation and cytokine production in Lrrc4b knockout models

    • Investigation of Lrrc4b expression changes during neuroinflammation

    • Assessment of pathogen responses in Lrrc4b-deficient neural cells

  • Therapeutic Implications:

    • If Lrrc4b modulates immune responses like LRRC4, it could represent a target for neuroinflammatory conditions

    • Understanding its role could inform approaches to CNS autoimmune diseases or neurodegenerative disorders with inflammatory components

How can single-cell techniques advance our understanding of Lrrc4b function in neural development?

Single-cell approaches offer powerful tools to dissect Lrrc4b function at unprecedented resolution:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Map Lrrc4b expression across neural cell types during development

    • Identify co-expressed genes to infer functional pathways

    • Compare expression patterns with known binding partners to predict where interactions occur

    • This approach aligns with paired spatiotemporal gene expression analysis used for other neural receptors

  • Single-Cell ATAC-seq:

    • Profile chromatin accessibility to identify regulatory elements controlling Lrrc4b expression

    • Discover transcription factors potentially regulating Lrrc4b in specific neural populations

    • Map enhancer usage across developmental trajectories

  • Spatial Transcriptomics:

    • Preserve spatial information while measuring gene expression

    • Correlate Lrrc4b expression with anatomical features and circuit formation

    • Identify spatial relationships between cells expressing Lrrc4b and potential interaction partners

  • CRISPR Perturbations at Single-Cell Resolution:

    • Perform pooled CRISPR screens with single-cell readouts to assess Lrrc4b function

    • Identify cell type-specific effects of Lrrc4b disruption

    • Map genetic interactions by combining Lrrc4b perturbation with other genes

  • Live Imaging of Lrrc4b Dynamics:

    • Create fluorescent reporters to track Lrrc4b localization in living neurons

    • Monitor protein dynamics during synapse formation and plasticity

    • Visualize interactions with binding partners using split fluorescent proteins

These approaches would enable researchers to construct dynamic maps of Lrrc4b function across neural development with unprecedented detail, similar to the neural intercellular recognition maps described for other LRR proteins .

What are the current challenges and future directions in therapeutic targeting of Lrrc4b signaling?

Exploring therapeutic applications targeting Lrrc4b presents several challenges and opportunities:

  • Knowledge Gaps:

    • Limited understanding of Lrrc4b-specific functions compared to other LRR family members

    • Incomplete characterization of tissue-specific roles and redundancy with related proteins

    • Unknown downstream signaling mechanisms specific to Lrrc4b

  • Targeting Strategies:

    • Recombinant Protein Approaches: Using purified Lrrc4b ectodomains to modulate receptor function

    • Antibody-Based Therapies: Developing function-blocking or function-enhancing antibodies against Lrrc4b

    • Small Molecule Modulators: Identifying compounds that affect Lrrc4b-protein interactions

    • Gene Therapy: Restoring Lrrc4b expression in conditions where it may be downregulated

  • Delivery Challenges:

    • Blood-brain barrier penetration for CNS applications

    • Achieving cell type-specific targeting

    • Controlling timing and duration of intervention

  • Potential Applications Based on Related Proteins:

    • Oncology: If Lrrc4b has tumor suppressor functions like LRRC4 in GBM

    • Neurodevelopmental Disorders: If involved in synapse formation like other LRR proteins

    • Neuroinflammatory Conditions: If it modulates immune responses in the CNS

  • Future Research Priorities:

    • Develop conditional knockout models to assess tissue-specific functions

    • Characterize binding partners and signaling pathways

    • Investigate genetic associations with human diseases

    • Examine epigenetic regulation of Lrrc4b expression

    • Create high-throughput screening platforms to identify modulators

Research on miRNA regulation might offer promising therapeutic avenues, as studies on LRRC4 have shown that miR-101 can reverse promoter hypermethylation and induce re-expression of the protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.